Loading patent…
AssigneesDevelopment Center for Biotechnology, National Health Research Institutes
InventorsShih-Chong Tsai, Mingl Chang, Ta-Tung Yuan, Shih-Chi Tseng, Shyi-Jou Chen, Wei-Tso Chia, Hsin-Yun Wang, Neng-Yao Shih, Ko-Jiunn Liu, Li-Tzong Chen
Estimating the term…
A method for treating an inflammatory disease or an immune disorder includes administering to a subject in need of such treatment an antagonist against ENO1. The antagonist binds ENO1 and inhibits ENO1 plasminogen receptor activity. The antagonist may be an anti-human ENO1 antibody, or an scFv, Fab, or F(ab)2 fragment thereof, that specifically binds to human ENO1 (GenBank: AAH50642.1) for the treatment of an inflammatory disease or an immune disorder, which may be multiple sclerosis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, systemic Lupus erythematosus, chronic obstructive pulmonary disease (COPD), asthma, allergy, psoriasis, type 1 diabetes mellitus, artherosclerosis or osteoporosis.
An antibody, or an scFv, Fab or F(ab)2 fragment thereof, wherein the antibody, or the scFv or Fab or F(ab)2 fragment thereof, can bind to an epitope on human ENO1 and inhibit ENO1 plasminogen receptor activity, wherein the epitope is located in a region consisting of the sequence of 296FDQDDWGAWQKFTASAGIQVVGDDLTVTNPK RIAKAVNEKS336 (SEQ ID NO:39) of human ENO1.
Dependencies are inferred from the claim text.