Back to results
US 8,569,447 B2Granted
Cell-permeable peptide inhibitors of the JNK signal transduction pathway
AssigneeXigen SA
InventorChristophe Bonny
Life of this patent
Estimating the term…
Abstract
The invention provides cell-permeable peptides that bind to JNK proteins and inhibit JNK-mediated effects in JNK-expressing cells.
Claims5
A peptide consisting of an amino acid sequence that is at least 95% identical to an amino acid sequence selected from the group consisting of the amino acid sequences SEQ ID NO:23, the amino acid sequence of TDQSRPVQPFLNLTTPRKPR in which all of the amino acids are in the D configuration, and the amino acid sequence of TDQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG in which all of the amino acids are in the D configuration, wherein the peptide directly inhibits at least one c-Jun amino terminal kinase (JNK) protein.
Dependencies are inferred from the claim text.