Prokineticin 2β peptide and its use
AssigneeJanssen Pharmaceutica NV
InventorsChanglu Liu, Jingcai Chen
Life of this patent
Estimating the term…
Abstract
A PK2β peptide is described, which, as an agonist of prokineticin receptor 1, is useful for treating lung and gastrointestinal diseases or disorders mediated by PKR1 activity.
Claims3
An isolated and purified peptide consisting of an amino acid sequence selected from the group consisting of AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQE (SEQ.ID.NO.:1) and AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQE (SEQ.ID.NO.:2), or a salt, amide, or ester thereof.
An isolated and purified PK2β peptide having the amino acid sequence of SEQ.ID.NO.:1.
An isolated and purified PK2β peptide having the amino acid sequence of SEQ.ID.NO.:2.
Dependencies are inferred from the claim text.