Metal-binding therapeutic peptides
AssigneeOntherix, Inc.
InventorDesmond Mascarenhas
Life of this patent
Estimating the term…
Abstract
The present invention is related methods of delivering MBD peptide-linked agents into live cells. The methods described herein comprise contacting MBD peptide-linked agents to live cells under a condition of cellular stress. The methods of the invention may be used for therapeutic or diagnostic purposes.
Claims24
A polypeptide comprising the amino acid sequence KKGFYKKKQCRPSKGRKRGFCWAVAEYARVQKRK (SEQ ID NO:
- 21).
A polypeptide comprising the amino acid sequence KGFYKKKQCRPSKGRKRGFCWAVAEYARVQKRK (SEQ ID NO:
- 46).
A polypeptide comprising the amino acid sequence AVAEYARVQKRKGFYKKKQCRPSKGRKRGFCWKALYWDLYE (SEQ ID NO :213).
A polypeptide comprising the amino acid sequence AVAEYAWVQKRKGFYKKKQCRPSKGRKRGFCWKALYWDLYE (SEQ TD NO:2 14).
A polypeptide comprising the amino acid sequence ETFSDVWKLLKKGFYKKKQCRPSKGRKRGFCWAVAEYARVQKRK (SEQ ID NO:222).
A polypeptide comprising the amino acid sequence ETFSDIWKLLKKGFYKKKQCRPSKGRKRGFCWAVAEYARVQKRK (SEQ ID NO :223).
Dependencies are inferred from the claim text.