Treatment and detection of infection and disease associated with different fungal pathogens
AssigneeUniversity of Georgia Research Foundation, Inc.
InventorsKaren A. Norris, Whitney Rabacal, Emily Rayens
Life of this patent
Estimating the term…
Abstract
Described are immunogenic compositions comprising a non-naturally occurring pan-fungal Kex peptide, and methods of using such compositions for the treatment or prevention of infection and/or diseases associated with fungal pathogens (e.g., Pneumocystis, Aspergillus, Candida, or Cryptococcus) in the subject. Also provided are compositions and kits for detecting or quantifying the presence of antibodies directed against a non-naturally occurring pan-fungal Kex peptide in a subject.
Claims20
An immunogenic peptide, or a polynucleotide encoding an immunogenic peptide, having at least 95% or more sequence identity to amino acid sequence PDDGKTMEGPDILVLRAFINGVQNGRDGKGSIYVFASGNGGGFEDNCNFDGYTNSIY SITVGAIDRKGLHPSYSEACSAQLVVTYSSGSG as set forth in SEQ ID NO:
- 2 (Pan-fungal peptide 2), or an immunogenic portion thereof.
An immunogenic peptide, or a polynucleotide encoding an immunogenic peptide, wherein the immunogenic peptide comprises or consists of amino acid sequence PDDGKTMEGPDILVLRAFINGVQNGRDGKGSIYVFASGNGGGFEDNCNFDGYTNSIY SITVGAIDRKGLHPSYSEACSAQLVVTYSSGSG as set forth in SEQ ID NO:
- 2 (Pan-fungal peptide 2), or an immunogenic portion thereof.
Dependencies are inferred from the claim text.