Bipartite molecules and uses thereof in treating diseases associated with abnormal protein aggregates

A method for treating a disease associated with an abnormal protein aggregate comprising administering to a subject in need thereof an effective amount of a pharmaceutical composition, wherein the pharmaceutical composition comprises a bipartite molecule and a pharmaceutically acceptable carrier, and the bipartite molecule is selected from the group consisting of:

• (a) a molecule comprising the amino acid sequences of RRRRRRRRGSNKGAIIGLM-PEI (SEQ ID NO:
• 4), wherein the C-terminal PEI is polyethylenimine;
• (b) a molecule comprising the amino acid sequences of YEVHHQKLVFFAEDDPGSNKGAIIGLMVGGVV-PEI (SEQ ID NO:
• 5), wherein the C-terminal PEI is polyethylenimine;
• (c) a molecule comprising the amino acid sequences of RRRRRRRRWDQQQQQQQQQQ (SEQ ID NO:
• 6);
• and
• (d) a molecule comprising the amino acid sequences of
• (SEQ ID NO:
• 7)
• RRRRRRRRWDQQQQQQQQQQQQQQQ.