Loading patent…
AssigneeThe Board of Regents of the University of Texsas System
InventorsThomas G. BOYER, Jason M. SPAETH, Alison D. CLARK
Estimating the term…
Certain embodiments are directed to compositions and methods for treating conditions associated Med12 mutations. Certain embodiments are directed to a peptide comprising all or part of an amino acid sequence that is at least 90% identical to the ammo acid sequence of MAAFGILSYEHRPLKRPRLGPPDVYPQDPKQKEDELTALNVKQGFNNQPAVSGDEHGSAKNVSFNPAKISSNFSSIIAEKLRCNTLPDT (SEQ ID NO:1). In certain aspects a peptide can comprise 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 consecutive amino acids that is 90, 95, or 100% identical SEQ ID NO:1. In certain embodiments a peptide described herein can be comprised in a pharmaceutical composition. Certain aspects are directed to an expression vector encoding a peptide as described herein.
A method of treatment comprising administering a polypeptide having an amino acid sequence at least 90% identical to the amino acid sequence of MAAFGILSYEHRPLKRPRLGPPDVYPQDPKQKEDELTALNVKQGFNNQPAVSGDEH GSAK NVSFNPAKISSNFSSIIAEKLRCNTLPDT (SEQ ID NO:1) to a subject having or suspected of having uterine leiomyomas.
A peptide comprising an amino acid sequence at least 90% identical to the amino acid sequence of MAAFGILSYEHRPLKRPRLGPPDVYPQDPKQKEDELTALNVKQGFNNQPAVSGDEH GSAK NVSFNPAKISSNFSSIIAEKLRCNTLPDT (SEQ ID NO:1).
Dependencies are inferred from the claim text.