Loading patent…
AssigneeBiomarin Pharmaceutical Inc.
InventorsDaniel J. Wendt, Shinong Long, Sianna Castillo, Christopher P. Price, Mika Aoyagi-Scharber, Michel Claude Vellard, Augustus O. Okhamafe
Estimating the term…
The present disclosure provides variants of C-type natriuretic peptide (CNP), pharmaceutical compositions comprising CNP variants, and methods of making CNP variants. The CNP variants are useful as therapeutic agents for the treatment of diseases responsive to CNP, including but not limited to bone-related disorders, such as skeletal dysplasias (e.g., achondroplasia), and vascular smooth muscle disorders (e.g., restenosis and arteriosclerosis).
1-49. (canceled)
A pharmaceutical composition comprising a C-type natriuretic peptide and an antioxidant, wherein the C-type natriuretic peptide consists of the amino acid sequence PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (SEQ ID NO:145).
Dependencies are inferred from the claim text.