US 2016/0243211 A1Published application

Vaccine comprising protein nmb0964 from neisseria meningitidis

AssigneeGlaxosmithkline Biologicals SA

InventorsMartine Petronella Bos, Jan Poolman, Michiel Stork, Johannes Petrus Maria Tommassen, Vincent Weynants

Life of this patent

Estimating the term…

Loading patent…

Abstract

The present invention relates to immunogenic compositions comprising neisserial blebs with upregulated levels of the NMB0964 antigens such that bactericidal antibodies are generated against said antigen. It has been found for the first time that this antigen's expression is zinc regulated and therefore methods are provided to upregulated expression through removal of the zinc repression mechanism of the cell or promoter, or through removal of zinc from the culture medium.

Claims4

Dependent claims

An immunogenic composition comprising:

(a) a Zn2+ salt;
(b) a pharmaceutically acceptable excipient;
and
(c) a polypeptide selected from the group consisting of:
(i) a polypeptide comprising an amino acid sequence having 95% identity to the amino acid sequence RDQYGLPAHSHEYDDCHADIIWQKSLINKRYLQLYPHLLTEEDIDYDNPGLSCGFHDDDNAHAHT HS (SEQ NO:
18), and
(ii) a polypeptide comprising an immunogenic fragment of 20 or more contiguous amino acids of the amino acid sequence RDQYGLPAHSHEYDDCHADIIWQKSLINKRYLQLYPHLLTEEDIDYDNPGLSCGFHDDDNAHAHT HS (SEQ NO:
18).

5 more elements

Dependencies are inferred from the claim text.

Facts

Application: 14/990,142Filed 7 Jan 2016
Priority: GB 0816447.78 Sep 2008
Published: 25 Aug 2016
Term ends: Not estimatedThe source records don’t support an estimate.

Classification13 codes

A61K 39/095
Bacterial antigens: neisseria
A61P 13/02
Drugs for disorders of the urinary system: of urine or of the urinary tract, e.g. urine acidifiers
A61P 15/00
Drugs for genital or sexual disorders
A61P 31/04
Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics: antibacterial agents

Family

Application13/062,319Division · filed 4 Mar 2011
Application14/990,142Division
US 2011/0189215 A1Published application
US 9,259,461 B2Related patent
US 2016/0243211 A1This patent

From the US filing history. Foreign family members aren’t listed.

Timeline

Citations

Open elsewhere

Building an agent or pulling many patents? Use the API or MCP server instead of scraping pages. Get an API key