Drug fusions and conjugates
AssigneeGlaxo Group Limited
InventorsChristopher Herring, Lucy J. Holt, Laurent S. Jespers, Sebastian Mayer, Malgorzata Pupecka-Swider, Bruce J. Hamilton
Life of this patent
Estimating the term…
Abstract
The present invention relates to drug fusions that have improved serum half lives. These fusions and conjugates comprise polypeptides, immunoglobulin (antibody) single variable domains and GLP and/or exendin molecules. The invention further relates to uses, formulations, compositions and devices comprising such drug fusions and conjugates.
Claims16
A drug fusion or conjugate comprising:
- (a) an insulinotropic agent or an incretin drug selected from:
- (i) GLP-1, (ii) exendin-4, and (iii) PYY (Peptide YY), present as a fusion or a conjugate;
- and
- (b) a dAb which binds serum albumin selected from:
- (i) the DOM 7h-14-10 domain antibody (dAb) (SEQ ID NO 26);
- (ii) the DOM 7h-11-15 dAb (SEQ ID NO 27);
- or (iii) the DOM 7h-14-10R108C domain antibody (dAb) (SEQ ID NO 42);
- wherein the fusion or conjugate has an elimination half life in a human of 12 hours or more.
A method of treating a metabolic disorder selected from the group consisting of hyperglycemia, impaired glucose tolerance, beta cell deficiency, diabetes (type 1 or type 2 diabetes or gestational diabetes), and obesity, wherein said method comprises administering Exendin 4, (G4S)3, linker DOM7h-14-10 fusion (DMS7139)
- (SEQ ID NO 24)
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSGGGGGSGGGG
- SGGGGSDIQMTQSPSSLSASVGDRVTITCRASQWIGSQLSWYQQKPGKA
- PKLLIMWRSSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCAQGL
- RHPKTFGQGTKVEIKR
- to a subject.
Dependencies are inferred from the claim text.