Neuromedin and FN-38 Peptides for Treating Psychiatric Diseases
AssigneeAmylin Pharmaceuticals, Inc.
InventorsKevin D. Laugero, Michael R. Hanley, David G. Parkers, Paul Mcgonigle
Life of this patent
Estimating the term…
Abstract
Methods and compositions for treating psychiatric diseases and disorders are disclosed. The methods provided generally involve the administration of an NMX peptide, an FNX peptide, or an NMX receptor agonist, or analogs or derivatives thereof, to a subject in order to treat psychiatric diseases and disorders, and conditions associated with psychiatric diseases and disorders.
Claims21
1-15. (canceled)
A method for treating a psychotic disorder in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a neuromedin peptide or an FN38 peptide to treat the psychotic disorder.
A method for treating an anxiety disorder in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a neuromedin peptide or an FN38 peptide to treat the anxiety disorder.
A method for treating schizophrenia in a human in need thereof comprising administering to the human a therapeutically effective amount of a peptide comprising the amino acid sequence of FLFHYSKTQKLGKSNVVEELQSPFASQSRGYFLFRPRN-NH2 (SEQ ID NO:5) to treat the schizophrenia.
Dependencies are inferred from the claim text.