Back to results
US 11,305,021 B2Granted
Membrane-lytic block copolymers
AssigneeUniversity of Washington
InventorsYilong Cheng, Suzie H. Pun
Life of this patent
Estimating the term…
Abstract
Membrane-lytic block copolymers, micellar assemblies, pharmaceutical compositions, and related methods are described.
Claims21
A block copolymer of formula (II):
- wherein
- each A1 is a hydrophilic monomer-derived unit,
- each A2 is a monomer-derived unit that is either independently neutral or charged at pH 10 or less;
- each A3 is a monomer-derived unit including a therapeutic agent;
- each A4 is a monomer-derived unit with a pKa ranging from about pH 4 to about pH 7;
- each A5 is a monomer-derived unit including a therapeutic agent;
- A6 is a monomer-derived unit including a membrane-lytic peptide;
- T1 is absent or a targeting group;
- T2 is absent, a membrane-lytic peptide, or a therapeutic agent;
- m is from 1 to about 10,000;
- n is from 0 to about 10,000;
- o is from 0 to about 10,000;
- p is from 1 to about 10,000;
- q is from 0 to about 10,000;
- and
- r is from 1 to about 10,000.
13 more elements
A block copolymer of formula (II):
- wherein
- each A1 is a hydrophilic monomer-derived unit,
- each A2 is a monomer-derived unit that is either independently neutral or charged at pH 10 or less;
- each A3 is a monomer-derived unit including a therapeutic agent;
- each A4 is a monomer-derived unit with a pKa ranging from about pH 4 to about pH 7;
- each A5 is a monomer-derived unit including a therapeutic agent;
- A6 is a monomer-derived unit including a membrane-lytic peptide;
- T1 is absent or a targeting group;
- T2 is a membrane-lytic peptide;
- m is from 1 to about 10,000;
- n is from 0 to about 10,000;
- o is from 0 to about 10,000;
- p is from 1 to about 10,000;
- q is from 0 to about 10,000;
- and
- r is from 0 to about 10,000.
13 more elements
A block copolymer of formula (II):
- wherein
- each A1 is a hydrophilic monomer-derived unit, each A2 is a monomer-derived unit that is either independently neutral or charged at pH 10 or less;
- each A3 is a monomer-derived unit including a therapeutic agent;
- each A4 is a monomer-derived unit with a pKa ranging from about pH 4 to about pH 7;
- each A5 is a monomer-derived unit including a therapeutic agent;
- A6 is a monomer-derived unit including a membrane-lytic entity;
- T1 is absent or a targeting group;
- T2 is absent, a membrane-lytic entity, or a therapeutic agent;
- m is from 1 to about 10,000;
- n is from 0 to about 10,000;
- o is from 0 to about 10,000;
- p is from 1 to about 10,000;
- q is from 0 to about 10,000;
- and
- r is from 1 to about 10,000,
- wherein the membrane-lytic entity is selected from the group consisting of melittin, peptides from adeno virus protein VI, GALA, KALA, EGLA, JTS1, Gramicidin S, HGP peptide (sequence LLGRRGWEVLKYWWNLLQYWSQEL) (SEQ ID NO:1), sHGP peptide (sequence RGWEVLKYWWNLLQY) (SEQ ID NO:2), TAT peptide (sequence GRKKRRQRRRPQ) (SEQ ID NO:3), oligoarginine, CaLL (KWKLFKKIFKRIVQRIKDFLR) (SEQ ID NO:4), hadrurin (GILDTIKSIASKVWNSKTVQDLKRKGINWVANKLGVSPQAA) (SEQ ID NO:5), cupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME) (SEQ ID NO:6), crabolin (Fmoc-FLALILRKIVTAL-CONH2) (SEQ ID NO:7), IsCT (ILGKIWEGIKSLF-NH2) (SEQ ID NO:8), HsAP (SGTSEKERESGRLLGVVKRLIVCFRSPFP-NH2) (SEQ ID NO:9), Pandinin2 (FWGALAKGALKLIPSLFSSFSKKD) (SEQ ID NO:10), Ponericin (WLGSALKIGAKLLPSVVGLFKKKKQ) (SEQ ID NO:11), UyCT5 (IWSAIWSGIKGLL-NH2) (SEQ ID NO:12) and hemagglutinin.
13 more elements
Dependencies are inferred from the claim text.