Diagnostic reagents
AssigneeThe Secretary of the State for Environment, Food & Rural Affairs acting through the Animal and Veterinary Laboratories Agency
InventorsGareth Jones, Hans Vordermeier
Life of this patent
Estimating the term…
Abstract
There is provided a diagnostic reagent useful to determine whether an animal has a tuberculosis infection or has been exposed to a tuberculosis agent, for example a Mycobacterium. The reagent is useful to distinguish between such an animal and an animal which has been vaccinated against a tuberculosis infection.
Claims10
A diagnostic reagent comprising a polypeptide consisting of amino acid sequence QANLGEAAGTYVAADAAAAS (SEQ ID NO:8), wherein the diagnostic reagent is a sterile injectable preparation, and the diagnostic reagent optionally further comprises a polypeptide consisting of amino acid sequence MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQFNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT (SEQ ID NO:46).
A diagnostic reagent comprising a polypeptide consisting of amino acid sequence QANLGEAAGTYVAADAAAAS (SEQ ID NO:8), the diagnostic reagent optionally further comprising a polypeptide consisting of amino acid sequence MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQFNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT (SEQ ID NO:46),
- wherein the diagnostic reagent is a sterile injectable preparation,
- and wherein the diagnostic reagent is capable of eliciting a positive result when used in an assay to determine whether an animal has a tuberculosis infection or has been exposed to a tuberculosis agent, is capable of eliciting a negative result when the animal has been vaccinated against infection by a tuberculosis agent, and is capable of eliciting a negative result when the animal is unvaccinated and uninfected or unexposed to a tuberculosis agent.
Dependencies are inferred from the claim text.