Back to results
US 9,868,778 B2Granted
Antibody capable of binding to influenza virus
AssigneePanasonic Intellectual Property Management Co., Ltd.
InventorJin Muraoka
Life of this patent
Estimating the term…
Abstract
The present invention provides a novel antibody capable of binding to an influenza virus. The antibody directed to the present invention consists of the amino acid sequence represented by SEQ ID NO: 15 or SEQ ID NO: 16.
Claims2
An antibody that consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains:
- N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C wherein
- FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence;
- the CDR1 consists of an amino acid sequence represented by GFTFERFDMG (SEQ ID NO:
- 1);
- the CDR2 consists of an amino acid sequence represented by RFNSDDGRKSYADAVKG (SEQ ID NO:
- 3);
- the CDR3 consists of an amino acid sequence represented by SQAYTSSTDTSSTDAEDR (SEQ ID NO:
- 5);
- the FR1 consists of an amino acid sequence represented by EVQLVESGGGFVQPGGSLRLSCVAS (SEQ ID NO:
- 7);
- the FR2 consists of an amino acid sequence represented by WVRQAPGKSLEWVS (SEQ ID NO:
- 8);
- the FR3 consists of an amino acid sequence represented by RFAISRDNAENTLYLQMNNLIPEDTATYYCVK (SEQ ID NO:
- 9);
- the FR4 consists of an amino acid sequence represented by GQGTQVTVSSEPKTPKPQSA (SEQ ID NO:
- 10);
- and
- the antibody is capable of binding to an H1N1 influenza virus.
15 more elements
An antibody that consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains:
- N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C wherein
- FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence;
- the CDR1 consists of an amino acid sequence represented by GRTFGAPYMA (SEQ ID NO:
- 2);
- the CDR2 consists of an amino acid sequence represented by GDSTYYADSMKN (SEQ ID NO:
- 4);
- the CDR3 consists of an amino acid sequence represented by DKWPFTGDVRSAGGYDY (SEQ ID NO:
- 6);
- the FR1 consists of an amino acid sequence represented by QVQLVESGGGLVQAGDSLRLSCAAA (SEQ ID NO:
- 11);
- the FR2 consists of an amino acid sequence represented by WFRQAPGKEREFVAGISWS (SEQ ID NO:
- 12);
- the FR3 consists of an amino acid sequence represented by RFTISRDNAKNTVYLQMNSLNPEDTAVYYCAA (SEQ ID NO:
- 13);
- the FR4 consists of an amino acid sequence represented by WGQGTQVTVSSEPKTPKPQSA (SEQ ID NO:
- 14);
- and
- the antibody is capable of binding to an H1N1 influenza virus.
15 more elements
Dependencies are inferred from the claim text.