Treatment of disease conditions via administration of DNA repair enzyme
AssigneeUniversity of South Alabama
InventorsGlenn Wilson, Susan Ledoux, Mikhail Alexeyev, Inna Shokolenko, Mark N. Gillespie
Life of this patent
Estimating the term…
Abstract
The present invention is directed to compositions and methods of preserving viability of islets of Langerhans for transplantation, and treating various disease and other abnormal or pathological conditions, including inflammatory bowel disease, ischemic heart disease, acute lung injury, acute respiratory distress syndrome and radiation-induced brain injury, with DNA repair enzymes that are directed to the mitochondria.
Claims21
A multi-domain conjugate comprising, from N-terminus to C-terminus, a mitochondrial targeting sequence, a DNA repair enzyme comprising human 8-oxoguanine DNA glycosylase (hOGG1) or Endo III (Endonuclease III), and a protein transduction domain.
A multi-domain conjugate comprising, from N-terminus to C-terminus, a mitochondrial targeting sequence, wherein the mitochrondrial targeting sequence is MLFNLRILLNNAFRNGHNFMVRNFRCGQPLQ (SEQ ID NO:4), a DNA repair enzyme comprising human 8-oxoguanine DNA glycosylase (hOGG1) or Endo III (Endonuclease III), and a protein transduction domain.
A multi-domain conjugate comprising, from N-terminus to C-terminus, a mitochondrial targeting sequence, a DNA repair enzyme comprising human 8-oxoguanine DNA glycosylase (hOGG1) or Endo III (Endonuclease III), and a protein transduction domain, wherein the protein transduction domain is RQIKIWFQNRRMKWKK (SEQ ID NO:10).
Dependencies are inferred from the claim text.