# US 9,085,643 B2 · Biologically active complex and its preparation > Agents: this data is available as JSON from the patentgrep API and MCP server — see https://patentgrep.com/llms.txt - Number: US 9,085,643 B2 - Document ID: US9085643B2 - Status: Granted - Kind: B2 - Application number: 13/988,878 - Filed: 2011-11-24 - Published: 2014-02-20 - Granted: 2015-07-21 - Earliest claimed: 2010-11-24 - Assignees: Hamlet Pharma AB - Applicants: Catharina Svanborg; Kenneth Hun Mok; Maria Trulsson; Ann-Kristin Mossberg; Petter Storm; Chin Shing Ho - Inventors: Catharina Svanborg; Kenneth Hun Mok; Maria Trulsson; Ann-Kristin Mossberg; Petter Storm; Chin Shing Ho - Web page: https://patentgrep.com/patent/US9085643B2 ## CPC - C07K 14/00: Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof - A61K 31/201: having one or two double bonds, e.g. oleic, linoleic acids - A61K 38/16: Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof {(enzyme inhibitors A61K38/005)} - A61P 35/00: Antineoplastic agents - C07K 14/76: Albumins - C12Q 1/18: Testing for antimicrobial activity of a material - G01N 33/5011: {for testing antineoplastic activity} - G01N 33/6872: {Intracellular protein regulatory factors and their receptors, e.g. including ion channels} - C07K: PEPTIDES (peptides in foodstuffs A23; obtaining protein compositions for foodstuffs, working-up proteins for foodstuffs A23J; preparations for medicinal purposes A61K; peptides containing beta-lactam rings C07D; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, C07D; ergot alkaloids of the cyclic peptide type C07D519/02; macromolecular compounds having statistically distributed amino acid units in their molecules, i.e. when the preparation does not provide for a specific; but for a random sequence of the amino acid units, homopolyamides and block copolyamides derived from amino acids C08G69/00; macromolecular products derived from proteins C08H1/00; preparation of glue or gelatine C09H; single cell proteins, enzymes C12N; genetic engineering processes for obtaining peptides C12N15/00; compositions for measuring or testing processes involving enzymes C12Q; investigation or analysis of biological material G01N33/00) - A61K: PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES (devices or methods specially adapted for bringing pharmaceutical products into particular physical or administering forms A61J3/00; chemical aspects of, or use of materials for deodorisation of air, for disinfection or sterilisation, or for bandages, dressings, absorbent pads or surgical articles A61L; soap compositions C11D) - A61P: SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS - C12Q: MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS (immunoassay G01N33/53); COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES - G01N: INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES (measuring or testing apparatus or processes other than immunoassay, involving enzymes or microorganisms C12M, C12Q) ## Abstract A biologically active complex comprising either a polypeptide having the sequence of a variant of a naturally occurring protein, wherein said polypeptide is at least partially unfolded as compared to the said naturally occurring protein; or a peptide of up to 50 amino acids, for instance a fragment of the naturally occurring protein or a variant thereof; and a pharmaceutically acceptable salt of a fatty acid or lipid. The complexes of the invention demonstrate a novel mode of action, that gives rise to opportunities for the development of further active agents and screening methods. ## Claims ### Claim 1 A biologically active complex comprising a peptide comprising the sequence KQFTKXELSQLLKDIDGYGGIALPELIXTMFHTSGYDTQA (SEQ ID NO: 3), wherein X is an amino acid residue other than cysteine and the peptide is up to 50 amino acids in length, and a pharmaceutically acceptable salt of a fatty acid or lipid. ### Claim 2 (depends on 1) The biologically active complex of claim 1, wherein the peptide comprises the sequence KQFTKAELSQLLKDIDGYGGIALPELIATMFHTSGYDTQA (SEQ ID NO: 5). ### Claim 3 (depends on 1) The biologically active complex of claim 1, wherein the salt of the fatty acid or lipid is a sodium or potassium salt. ### Claim 4 (depends on 1) The biologically active complex of claim 1, wherein the salt of the fatty acid or lipid is a salt of oleic acid. ### Claim 5 (depends on 1) The biologically active complex of claim 1, which further comprises a secondary reagent. ### Claim 6 (depends on 1) A pharmaceutical composition comprising the biologically active complex of claim 1 and a pharmaceutically acceptable carrier. ### Claim 7 A method for preparing a biologically active complex comprising a peptide comprising SEQ ID NO: 3, wherein the peptide is up to 50 amino acids in length, and a pharmaceutically acceptable salt of a fatty acid or lipid, wherein the method comprises mixing together the peptide and the salt of a fatty acid or lipid. ### Claim 8 A method for treating a cancer selected from the group consisting of skin papilloma, bladder cancer, glioblastoma, lung cancer, kidney cancer, ovarian cancer, and lymphoma, the method comprising administering to a patient in need thereof a biologically active complex comprising a peptide comprising SEQ ID NO: 3, wherein the peptide is up to 50 amino acids in length, and a fatty acid or lipid salt, or a pharmaceutical composition comprising the biologically active complex. ### Claim 9 (depends on 8) The method of claim 8, wherein the peptide comprises SEQ ID NO: 5. ### Claim 10 (depends on 8) The method of claim 8, wherein the fatty acid or lipid salt is an oleate salt. ### Claim 11 A kit comprising a peptide comprising SEQ ID NO: 3, wherein the peptide is up to 50 amino acids in length, and a pharmaceutically acceptable salt of a fatty acid or lipid. ### Claim 12 (depends on 11) The kit of claim 11, wherein the peptide comprises SEQ ID NO: 5. ### Claim 13 (depends on 11) The kit of claim 11, wherein the salt of the fatty acid or lipid is a salt of oleic acid. ### Claim 14 A peptide consisting of SEQ ID NO: 3. ### Claim 15 (depends on 14) The peptide of claim 14, wherein the peptide consists of SEQ ID NO:5.