Antichlamydial agents
AssigneeDuke University
InventorsMaria M. Bednar, Ine Jorgensen, Dewey G. McCafferty, Raphael H. Valdivia
Life of this patent
Estimating the term…
Abstract
An antichlamydial agent comprising an inhibitor of Chlamydial Protease-like Activity Factor (CPAF). The inhibitor of CPAF can comprise a CPAF inhibitory segment and can optionally include one or more additional residues or domains. Also provided are compositions comprising an inhibitor of CPAF, methods of identifying an inhibitor of CPAF, and methods of treating a Chlamydia infection in a subject comprising administering an inhibitor of CPAF or a composition comprising an inhibitor of CPAF to the subject.
Claims15
An isolated inhibitor of Chlamydial Protease-like Activity Factor (CPAF), wherein the isolated inhibitor consists of SEQ ID NO:2 (SLFYSPMVPHFWAELRNHYATSGLK).
An isolated inhibitor of Chlamydial Protease-like Activity Factor (CPAF) wherein the isolated inhibitor consists of SEQ ID NO:6 (SLFYSPMVPHFWAELRNHYATSGLKX1X2X3X4X5X6X7X8X9X10), wherein each amino acid X1-X10 is optionally absent and each is independently selected from the group consisting of arginine (R), histidine (H), lysine (K), aspartate (D), and glutamate (E).
An isolated inhibitor of Chlamydial Protease-like Activity Factor (CPAF) wherein the isolated inhibitor comprises SEQ ID NO:7 (SLFYSPMVPHFWAELRNHYATSGLKRRRRRRRRR).
Dependencies are inferred from the claim text.