# US 8,569,447 B2 · Cell-permeable peptide inhibitors of the JNK signal transduction pathway

> Agents: this data is available as JSON from the patentgrep API and MCP server — see https://patentgrep.com/llms.txt

- Number: US 8,569,447 B2
- Document ID: US8569447B2
- Status: Granted
- Kind: B2
- Application number: 13/554,413
- Filed: 2012-07-20
- Published: 2013-03-07
- Granted: 2013-10-29
- Earliest claimed: 2003-06-09
- Assignees: Xigen SA
- Applicants: Christophe Bonny
- Inventors: Christophe Bonny
- Web page: https://patentgrep.com/patent/US8569447B2

## CPC

- C07K 14/00: Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K 38/1709: {from mammals}
- A61P 17/14: for baldness or alopecia
- A61P 25/00: Drugs for disorders of the nervous system
- A61P 25/28: for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
- A61P 37/02: Immunomodulators
- C07K 14/4703: {Inhibitors; Suppressors}
- C07K 2319/00: Fusion polypeptide
- C07K: PEPTIDES (peptides in foodstuffs A23; obtaining protein compositions for foodstuffs, working-up proteins for foodstuffs A23J; preparations for medicinal purposes A61K; peptides containing beta-lactam rings C07D; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, C07D; ergot alkaloids of the cyclic peptide type C07D519/02; macromolecular compounds having statistically distributed amino acid units in their molecules, i.e. when the preparation does not provide for a specific; but for a random sequence of the amino acid units, homopolyamides and block copolyamides derived from amino acids C08G69/00; macromolecular products derived from proteins C08H1/00; preparation of glue or gelatine C09H; single cell proteins, enzymes C12N; genetic engineering processes for obtaining peptides C12N15/00; compositions for measuring or testing processes involving enzymes C12Q; investigation or analysis of biological material G01N33/00)
- A61K: PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES (devices or methods specially adapted for bringing pharmaceutical products into particular physical or administering forms A61J3/00; chemical aspects of, or use of materials for deodorisation of air, for disinfection or sterilisation, or for bandages, dressings, absorbent pads or surgical articles A61L; soap compositions C11D)
- A61P: SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS

## Abstract

The invention provides cell-permeable peptides that bind to JNK proteins and inhibit JNK-mediated effects in JNK-expressing cells.

## Claims

### Claim 1

A peptide consisting of an amino acid sequence that is at least 95% identical to an amino acid sequence selected from the group consisting of the amino acid sequences SEQ ID NO:23, the amino acid sequence of TDQSRPVQPFLNLTTPRKPR in which all of the amino acids are in the D configuration, and the amino acid sequence of TDQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG in which all of the amino acids are in the D configuration, wherein the peptide directly inhibits at least one c-Jun amino terminal kinase (JNK) protein.

### Claim 2 (depends on 1)

The peptide of claim 1, wherein the peptide is at least 95% identical to the amino acid sequence TDQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG, in which all of the amino acids are in the D configuration.

### Claim 3 (depends on 1)

The peptide of claim 1, wherein the peptide is selected from the group consisting of the amino acid sequence SEQ ID NO: 23, the amino acid sequence TDQSRPVQPFLNLTTPRKPR in which all of the amino acids are in the D configuration, or the amino acid sequence TDQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG in which all of the amino acids are in the D configuration.

### Claim 4 (depends on 1, 2, 3)

A pharmaceutical composition comprising the peptide of any of claims 1-3 and a pharmaceutically acceptable carrier.

### Claim 5 (depends on 4)

The pharmaceutical composition of claim 4 that is formulated for administration by a route selected from a group consisting of intrauricular, intraperitoneal, nasal, intravenous, oral and patch delivery.