Back to results
US 8,263,743 B2Granted
Humanized antibodies against TL1A
AssigneeTeva Biopharmaceuticals USA, Inc.
InventorsRodger Smith, Palanisamy Kanakaraj, Viktor Roschke, Craig Rosen, Bridget A. Cooksey
Life of this patent
Estimating the term…
Abstract
Disclosed are humanized antibodies that bind specifically to the receptor TNF superfamily member 15 (TNFSF15), also known as TL1A. Methods of making and using the anti-TL1A antibodies are also described. The humanized antibodies may be antagonists and may used to treat or diagnose conditions associated with TL1A function.
Claims18
An isolated antigen-binding polypeptide that binds specifically to TL1A, comprising:
- (a) a humanized heavy chain variable region comprising:
- (1) a CDR-H1 comprising the amino acid sequence of TSNMGVV (SEQ ID NO:7);
- (2) a CDR-H2 comprising the amino acid sequence of HILWDDREYSNPALKS (SEQ ID NO:8);
- and
- (3) a CDR-H3 comprising the amino acid sequence of MSRNYYGSSYVMDY (SEQ ID NO:9);
- and
- (b) a humanized light chain variable region comprising:
- (1) a CDR-L1 comprising the amino acid sequence of SASSSVNYMH (SEQ ID NO:35);
- (2) a CDR-L2 comprising the amino acid sequence of STSNLAS (SEQ ID NO:36);
- and
- (3) a CDR-L3 comprising the amino acid sequence of HQWNNYGT (SEQ ID NO:37).
8 more elements
An antigen binding polypeptide that binds specifically to TL1A, comprising:
- (a) a humanized variable light chain region comprising the amino acid sequence:
- DIQLTQSPSFLSASVGDRVTITCSASSSVNYMHWYQQKPGKAPKLLIYSTSNLASGVP SRFSGSGSGTEFTLTISSLQPEDFATYYCHQWNNYGTFGQGTKVEIKR (SEQ ID NO:38);
- and
- (b) a humanized variable heavy chain region comprising the amino acid sequence:
- QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSNMGVVWIRQPPGKALEWLAHILWDD REYSNPALKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARMSRNYYGSSYVMD YWGQGTLVTVSS (SEQ ID NO:
- 10).
3 more elements
Dependencies are inferred from the claim text.