Method of detecting the cystic fibrosis transmembrane conductance regulator (CFTR) at cell exterior
OwnerJohn R. Riordaninventor
Life of this patent
Estimating the term…
Abstract
The present invention provides a recombinant nucleic acid encoding a modified cystic fibrosis transmembrane conductance regulator (CFTR) protein. The nucleic acid is modified by the insertion of a first heterologous segment encoding a detectable epitope in a region encoding an extracytoplasmic loop, such as at least one of EL1 through EL6. E12 is currently preferred. Proteins encoded by such nucleic acids, vectors and cells containing such nucleic acids, and methods of use thereof are also described.
Claims13
A recombinant nucleic acid encoding a modified human cystic fibrosis transmembrane conductance regulator (CFTR) protein, wherein said recombinant nucleic acid contains a nucleic acid segment encoding the peptide segment EL2:
- WELNTSYDPDNKGNTYPYDVPDYANSYAYIITSKEERSLQ (SEQ ID NO:23), and wherein said nucleic acid is modified by the insertion of a first heterologous segment encoding a detectable epitope in the region encoding the second extracellular cytoplasmic loop (EL2).
A recombinant nucleic acid encoding a modified human cystic fibrosis transmembrane conductance regulator (CFTR) protein, wherein said nucleic acid is modified by the insertion of a first heterologous segment encoding a detectable epitope in the region encoding the second extracellular cytoplasmic loop (EL2) between the regions coding for amino acids W216 and Q220 of the CFTR protein.
Dependencies are inferred from the claim text.