Antigenic HIV gp41 chimeric polypeptides comprising the MVP5180/91 epitope SKGKLIS
AssigneeSiemens Healthcare Diagnostics Products GmbH
InventorsStefan Brust, Stefan Knapp, Manfred Gerken, Lutz G. Guertler
Life of this patent
Estimating the term…
Abstract
Immunologically active peptides which are derived from a novel immunodeficiency virus which has the designation MVP5180/91 are described. A diagnostic composition containing such a peptide and methods of detecting an antibody against a retrovirus that causes immune deficiency using such diagnostic composition are also described. A kit containing the immunologically active peptides is also described. An immunogen and method of immunizing a mammal against HIV infection using the immunologically active peptides is described. DNA encoding the peptides and methods of detecting nucleic acids encoding HIV viruses are also described.
Claims13
An isolated immunologically active human immunodeficiency virus (HIV) chimeric polypeptide comprising the following:
- (a) at least 15 consecutive amino acids of SEQ ID NO.:
- 1 comprising the epitope XKGKLIX (amino acid residues 29-35 of SEQ ID NO.:
- 1) wherein X is S, and
- (b) one or more additional non-MVP5180/91 HIV-1 or HIV-2 amino acids at the amino-terminus and/or carboxyl-terminus,
- wherein said polypeptide is capable of binding to HIV-1-specific antibodies.
An isolated immunologically active human immunodeficiency virus type 1 (HIV-1) MVP5180/91 polypeptide comprising the amino acid sequence RLQALETLIQNQQRLNLWGSKGKLIS (SEQ ID NO.:
- 4).
An isolated immunologically active human immunodeficiency virus type 1 (HIV-1) MVP5180/91 polypeptide comprising the amino acid sequence VWGIRQLRARLQALETLIQNQQRLNLWGSKGKLISYTSVKWNTSWSGR (SEQ ID NO.:
- 1).
Dependencies are inferred from the claim text.