# US 7,612,163 B1 · Prokineticin 2β peptide and its use

> Agents: this data is available as JSON from the patentgrep API and MCP server — see https://patentgrep.com/llms.txt

- Number: US 7,612,163 B1
- Document ID: US7612163B1
- Status: Granted
- Kind: B1
- Application number: 10/594,832
- Filed: 2005-03-29
- Granted: 2009-11-03
- Earliest claimed: 2004-03-29
- Assignees: Janssen Pharmaceutica NV
- Inventors: Changlu Liu; Jingcai Chen
- Web page: https://patentgrep.com/patent/US7612163B1

## CPC

- C07K 14/47: from mammals
- A61P 1/00: Drugs for disorders of the alimentary tract or the digestive system
- A61P 1/04: for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
- A61P 1/06: Anti-spasmodics, e.g. drugs for colics, esophagic dyskinesia
- A61P 1/10: Laxatives
- A61P 11/00: Drugs for disorders of the respiratory system
- A61P 11/06: Antiasthmatics
- A61P 11/08: Bronchodilators
- A61P 11/16: Central respiratory analeptics
- A61P 29/00: Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
- A61P 35/00: Antineoplastic agents
- A61P 43/00: Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
- C07K: PEPTIDES (peptides in foodstuffs A23; obtaining protein compositions for foodstuffs, working-up proteins for foodstuffs A23J; preparations for medicinal purposes A61K; peptides containing beta-lactam rings C07D; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, C07D; ergot alkaloids of the cyclic peptide type C07D519/02; macromolecular compounds having statistically distributed amino acid units in their molecules, i.e. when the preparation does not provide for a specific; but for a random sequence of the amino acid units, homopolyamides and block copolyamides derived from amino acids C08G69/00; macromolecular products derived from proteins C08H1/00; preparation of glue or gelatine C09H; single cell proteins, enzymes C12N; genetic engineering processes for obtaining peptides C12N15/00; compositions for measuring or testing processes involving enzymes C12Q; investigation or analysis of biological material G01N33/00)
- A61P: SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS

## Abstract

A PK2β peptide is described, which, as an agonist of prokineticin receptor 1, is useful for treating lung and gastrointestinal diseases or disorders mediated by PKR1 activity.

## Claims

### Claim 1

An isolated and purified peptide consisting of an amino acid sequence selected from the group consisting of AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQE (SEQ.ID.NO.:1) and AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQE (SEQ.ID.NO.:2), or a salt, amide, or ester thereof.

### Claim 2

An isolated and purified PK2β peptide having the amino acid sequence of SEQ.ID.NO.:1.

### Claim 3

An isolated and purified PK2β peptide having the amino acid sequence of SEQ.ID.NO.:2.