# US 7,611,893 B2 · Metal-binding therapeutic peptides > Agents: this data is available as JSON from the patentgrep API and MCP server — see https://patentgrep.com/llms.txt - Number: US 7,611,893 B2 - Document ID: US7611893B2 - Status: Granted - Kind: B2 - Application number: 11/725,672 - Filed: 2007-03-19 - Published: 2008-05-29 - Granted: 2009-11-03 - Earliest claimed: 2005-11-09 - Assignees: Ontherix, Inc. - Inventors: Desmond Mascarenhas - Web page: https://patentgrep.com/patent/US7611893B2 ## CPC - C07K 14/4743: {Insulin-like growth factor binding protein} - A61K 47/66: the modifying agent being a pre-targeting system involving a peptide or protein for targeting specific cells - A61P 3/10: for hyperglycaemia, e.g. antidiabetics - A61P 9/00: Drugs for disorders of the cardiovascular system - A61P 25/00: Drugs for disorders of the nervous system - A61P 29/00: Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID] - A61P 35/00: Antineoplastic agents - B82Y 5/00: Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery - A61K 38/00: Medicinal preparations containing peptides (peptides containing beta-lactam rings A61K31/00; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, A61K31/00; ergot alkaloids of the cyclic peptide type A61K31/48; containing macromolecular compounds having statistically distributed amino acid units A61K31/74; medicinal preparations containing antigens or antibodies A61K39/00; medicinal preparations characterised by the non-active ingredients, e.g. peptides as drug carriers, A61K47/00) - C07K 2319/00: Fusion polypeptide - C07K 2319/01: containing a localisation/targetting motif - C07K: PEPTIDES (peptides in foodstuffs A23; obtaining protein compositions for foodstuffs, working-up proteins for foodstuffs A23J; preparations for medicinal purposes A61K; peptides containing beta-lactam rings C07D; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, C07D; ergot alkaloids of the cyclic peptide type C07D519/02; macromolecular compounds having statistically distributed amino acid units in their molecules, i.e. when the preparation does not provide for a specific; but for a random sequence of the amino acid units, homopolyamides and block copolyamides derived from amino acids C08G69/00; macromolecular products derived from proteins C08H1/00; preparation of glue or gelatine C09H; single cell proteins, enzymes C12N; genetic engineering processes for obtaining peptides C12N15/00; compositions for measuring or testing processes involving enzymes C12Q; investigation or analysis of biological material G01N33/00) - A61K: PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES (devices or methods specially adapted for bringing pharmaceutical products into particular physical or administering forms A61J3/00; chemical aspects of, or use of materials for deodorisation of air, for disinfection or sterilisation, or for bandages, dressings, absorbent pads or surgical articles A61L; soap compositions C11D) - A61P: SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS - B82Y: SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES ## Abstract The present invention is related methods of delivering MBD peptide-linked agents into live cells. The methods described herein comprise contacting MBD peptide-linked agents to live cells under a condition of cellular stress. The methods of the invention may be used for therapeutic or diagnostic purposes. ## Claims ### Claim 1 A polypeptide comprising the amino acid sequence KKGFYKKKQCRPSKGRKRGFCWAVAEYARVQKRK (SEQ ID NO: 21). ### Claim 2 (depends on 1) A composition comprising the polypeptide of claim 1 and a pharmaceutical excipient. ### Claim 3 (depends on 1) A nucleic acid encoding the polypeptide of claim 1. ### Claim 4 (depends on 3) A vector comprising the nucleic acid of claim 3. ### Claim 5 A polypeptide comprising the amino acid sequence KGFYKKKQCRPSKGRKRGFCWAVAEYARVQKRK (SEQ ID NO: 46). ### Claim 6 (depends on 5) A composition comprising the polypeptide of claim 5 and a pharmaceutical excipient. ### Claim 7 (depends on 5) A nucleic acid encoding the polypeptide of claim 5. ### Claim 8 (depends on 7) A vector comprising the nucleic acid of claim 7. ### Claim 9 A polypeptide comprising the amino acid sequence AVAEYARVQKRKGFYKKKQCRPSKGRKRGFCWKALYWDLYE (SEQ ID NO :213). ### Claim 10 (depends on 9) A composition comprising the polypeptide of claim 9 and a pharmaceutical excipient. ### Claim 11 (depends on 9) A nucleic acid encoding the polypeptide of claim 9. ### Claim 12 (depends on 11) A vector comprising the nucleic acid of claim 11. ### Claim 13 A polypeptide comprising the amino acid sequence AVAEYAWVQKRKGFYKKKQCRPSKGRKRGFCWKALYWDLYE (SEQ TD NO:2 14). ### Claim 14 (depends on 13) A composition comprising the polypeptide of claim 13 and a pharmaceutical excipient. ### Claim 15 (depends on 13) A nucleic acid encoding the polypeptide of claim 13. ### Claim 16 (depends on 15) A vector comprising the nucleic acid of claim 15. ### Claim 17 A polypeptide comprising the amino acid sequence ETFSDVWKLLKKGFYKKKQCRPSKGRKRGFCWAVAEYARVQKRK (SEQ ID NO:222). ### Claim 18 (depends on 17) A composition comprising the polypeptide of claim 17 and a pharmaceutical excipient. ### Claim 19 (depends on 17) A nucleic acid encoding the polypeptide of claim 17. ### Claim 20 (depends on 19) A vector comprising the nucleic acid of claim 19. ### Claim 21 A polypeptide comprising the amino acid sequence ETFSDIWKLLKKGFYKKKQCRPSKGRKRGFCWAVAEYARVQKRK (SEQ ID NO :223). ### Claim 22 (depends on 21) A composition comprising the polypeptide of claim 21 and a pharmaceutical excipient. ### Claim 23 (depends on 21) A nucleic acid encoding the polypeptide of claim 21. ### Claim 24 (depends on 23) A vector comprising the nucleic acid of claim 23.