Monoclonal antibody which agglutinates E. coli having the CS4-CFA/I family protein
AssigneeThe United States of America as represented by the Secretary of the Army
InventorsFrederick Cassels, Andrew Lees, Richard Schuman
Life of this patent
Estimating the term…
Abstract
A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO. 2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.
Claims7
A monoclonal antibody produced by hybridoma deposited as ATCC HB-12163 which agglutinates bacteria bearing CS4-CFA/I family of proteins and binds exclusively and specifically to amino acid sequence SAVALTYS (SEQ ID NO. 2).
Dependencies are inferred from the claim text.