Human NESP55 polypeptides, polynucleotides and uses thereof
AssigneeKnoll, Inc.
InventorsDouglas Fraser, Steven St. Gallay
Life of this patent
Estimating the term…
Abstract
A substantially pure polypeptide (human NESP55) comprising the amino acid sequence (SEQ ID NO: 2) IRLEVPKRMDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALL RALATSNARAQQRAAAQQRRSFLNAHHRSGAQVFPESPESESDHEHEEAD LELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETEPE DDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGE ELKPEDKDPRRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPIP IRRH or a variant, fragment, fusion or derivative thereof, or a fusion of a said variant or fragment or derivative, wherein the polypeptide variant has an amino acid sequence which has at least 90% identity with the amino acid sequence given above. NESP55 or fragments thereof may be useful in medicine for the treatment of obesity.
Claims6
An isolated polypeptide comprising an amino acid sequence, which is at least 98% identical to the amino acid sequence of SEQ ID NO:
- 2.
An isolated peptide consisting of the amino acid sequence LHAL (SEQ ID NO:
- 5).
An isolated peptide consisting of the amino acid sequence GPIPIRRH (SEQ ID NO:
- 6).
Dependencies are inferred from the claim text.