Subunit papilloma virus vaccine and peptides for use therein
AssigneesThe University of Queensland, CSL Limited
InventorsRobert Tindle, Germain Fernando, Ian Frazer
Life of this patent
Estimating the term…
Abstract
The invention relates to a subunit papillomavirus vaccine which is protective against anogenital human Papillomavirus (HPV) infection. Peptides are also provided, which constitute an antigenic component of the vaccine. The peptide includes the sequence DRAHYNI (SEQ ID NO:11) and structural homologues thereof which concern a single amino acid substitution. The peptide is linked directly or indirectly to one or more amino acid sequences which correspond to a B epitope HPV16 and HPV18. The DRAHYNI (SEQ ID NO:11) sequence corresponds to a T helper epitope sequence.
Claims23
A pharmaceutical composition comprising (i) a pharmaceutically acceptable adjuvant and (ii) an immunogenic peptide comprising (a) a T epitope which comprises the amino acid sequence DRAHYNI (SEQ ID NO:
- 11) and (b) one or more B epitopes of HPV 16 E7 protein or HPV 18 E7 protein, wherein the immunogenic peptide does not comprise the full-length HPV 16 E7 protein or the full-length HPV 18 E7 protein, and wherein the composition in use elicits a strong antibody response to challenge by at least one of the HPV 16 E7 protein and the HPV 18 E7 protein.
A pharmaceutical composition comprising (i) a pharmaceutically acceptable adjuvant and (ii) an immunogenic peptide comprising (a) a T epitope which comprises the amino acid sequence DRAHYNI (SEQ ID NO:11) and (b) at least one B epitopes of HPV 16 E7 protein or HPV 18 E7 protein, the B epitopes selected from the group consisting of QAEPD (SEQ ID NO:
- 12), IDGP (SEQ ID NO:
- 13), EYMLD (SEQ ID NO:14), YMLD (SEQ ID NO:
- 15), DEIDGVNHQHL (SEQ ID NO:
- 16) AND SEENED (SEQ ID NO:
- 17) wherein the immunogenic peptide does not comprise the full-length HPV 16 E7 protein or the full-length HPV 18 E7 protein.
A peptide consisting of the sequence QAEPDRAHYNIVTFCCKCD (SEQ ID NO:3).
A peptide consisting of the sequence QAEPDRAHYNI (SEQ ID NO:1).
A peptide consisting of the sequence QAEPDRAHYNIVTF (SEQ ID NO:4).
A peptide consisting of the sequence EIDGPAGQAEPDRAHYNIVT (SEQ ID NO:5).
A peptide consisting of the sequence QAEPDRAHYNIDEIDGVNHQHL (SEQ ID NO:6).
A peptide consisting of the sequence EYMLDAGIDGPAGQAEPDRAHYNIVTFCCKCD (SEQ ID NO:7).
A peptide consisting of the sequence RAHYNIVTFCCKCDQAEPDAGIDGPAGEYMLD (SEQ ID NO:8).
A peptide consisting of the sequence EIDGPAGQAEPDRAHYNI (SEQ ID NO:9).
A peptide consisting of the sequence GQAEPDRAHYNIVTFCCKCD (SEQ ID NO:10).
Dependencies are inferred from the claim text.