Back to results
US 5,849,705 AGranted
Method for the treatment of Schwann cells in vivo
AssigneeAmgen Inc.
InventorsJosette Francoise Carnahan, Shinichi Hara, Hsieng Sen Lu, John Philip Mayer
Life of this patent
Estimating the term…
Abstract
Schwann cells can be treated in vivo to survive longer and to proliferate by contacting them with peptides derived from the EGF-like domain of proteins of the NDF/heregulin family.
Claims4
A method for maintaining the survival of Schwann cells in vivo, comprising administering to an individual in need thereof an effective amount of a peptide having the following amino acid sequence:
- SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCQNYVMAS (SEQ ID NO:1).
Dependencies are inferred from the claim text.