Method for recombinant production of osteogenic protein
AssigneeStryker Corporation
InventorsHermann Oppermann, Thangavel Kuberasampath, David C. Rueger, Engin Ozkaynak
Life of this patent
Estimating the term…
Abstract
Disclosed are 1) osteogenic devices comprising a matrix containing osteogenic protein and methods of inducing endochondral bone growth in mammals using the devices; 2) amino acid sequence data, amino acid composition, solubility properties, structural features, homologies and various other data characterizing osteogenic proteins, 3) methods of producing osteogenic proteins using recombinant DNA technology, and 4) osteogenically and chondrogenically active synthetic protein constructs.
Claims13
A method for producing an OP-1 protein comprising the step of transforming a cell with a vector having inserted therein a DNA sequence which encodes an amino acid sequence comprising
- LYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCC APTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH,
- culturing said cells in a suitable culture medium, and isolating said OP-1 protein produced by said cell.
A method for producing an OP-1 protein which comprises transforming mammalian cells with an expression vector, said vector having inserted therein a DNA sequence comprising the sequence ##STR26## which encodes the amino acid sequence ##STR27## culturing said cells in a suitable culture medium, and isolating said OP-1 protein produced by said cells.
A method for producing recombinant OP-1 protein, said method comprising the steps of:
- (a) culturing in a suitable culture medium a mammalian cell transformed with a nucleic acid comprising a DNA sequence corresponding to the human gene encoding human OP-1 protein, said human gene comprising a nucleotide sequence encoding the amino acid sequence
- CKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAI VQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH or an allelic variant thereof, and,
- (b) isolating and purifying said protein from said culture medium.
Dependencies are inferred from the claim text.