Labelled .beta.-amyloid peptide and methods of screening for Alzheimer's disease
AssigneesRegents of the University of Minnesota, President and Fellows of Harvard College
InventorsJohn E. Maggio, Patrick W. Mantyh
Life of this patent
Estimating the term…
Abstract
The present invention provides: a labelled .beta.-amyloid peptide of active fragment; a composition including the labelled .beta.-amyloid peptide or active fragment thereof and a pharmaceutical carrier; a method for labelling the .beta.-amyloid peptide or an active fragment thereof, and methods of using the labelled peptide or peptide fragment for detecting or monitoring Alzheimer's disease in a patient.
Claims14
An in vitro method of screening for Alzheimer's disease in a patient comprising:
- (a) combining a sample of tissue from the patient with an amount of a labelled .beta.-amyloid peptide or a labelled peptide fragment thereof for a time and under conditions effective to allow binding of the labelled .beta.-amyloid peptide or labelled peptide fragment thereof to human amyloid plaques present in the tissue sample;
- and
- (b) detecting the presence of the labelled .beta.-amyloid peptide or labelled peptide fragment thereof bound to amyloid plaques in the tissue sample as a means of screening for Alzheimer's disease.
An in vitro method of screening for Alzheimer's disease in a patient comprising:
- (a) combining a sample of tissue from the patient with an amount of a radiolabelled .beta.-amyloid peptide having the amino acid sequence H DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH [SEQ. ID NO:1], H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH [SEQ. ID NO:2], or a radiolabelled peptide fragment thereof, for a time and under conditions effective to allow binding of the radiolabelled .beta.-amyloid peptide or radiolabelled peptide fragment thereof to human amyloid plaques present in the tissue sample;
- and
- (b) detecting the presence of the radiolabelled .beta.-amyloid peptide or radiolabelled peptide fragment thereof bound to amyloid plaques in the tissue sample as a means of screening for Alzheimer's disease.
An in vitro method of screening for Alzheimer's disease in a patient comprising:
- (a) combining a sample of tissue from the patient with an amount of a radiolabelled .beta.-amyloid peptide or a radiolabelled peptide fragment thereof for a time and under conditions effective to allow binding of the radiolabelled .beta.-amyloid peptide or radiolabelled peptide fragment thereof to human amyloid plaques present in the tissue sample;
- and
- (b) detecting the presence of the radiolabelled .beta.-amyloid peptide or radiolabelled peptide fragment thereof bound to amyloid plaques in the tissue sample as a means of screening for Alzheimer's disease;
- wherein the radiolabelled .beta.-amyloid peptide or radiolabelled peptide fragment thereof are obtained by dissolving a purified .beta.-amyloid peptide or peptide fragment thereof in a suitable reaction buffer and performing oxidative radioiodination on the dissolved .beta.-amyloid peptide or peptide fragment thereof to produce a radiolabelled .beta.-amyloid peptide or radiolabelled peptide fragment thereof.
Dependencies are inferred from the claim text.