Trigramin - a platelet aggregation inhibiting polypeptide
AssigneeTemple University of the Commonwealth System of Higher Education
InventorsTur-Fu Huang, Stefan Niewiarowski, John C. Holt, Hanna Lukasiewicz
Life of this patent
Estimating the term…
Abstract
Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets. Trigramin is thus a potent inhibitor of fibrinogen-induced human platelet aggregation. It is useful in inhibiting the formation of hemostatic platelet plugs.
Claims5
The polypeptide in substantially pure chemical form having the following amino acid sequence:
- EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH.
A preparation for inhibiting fibrinogen-induced aggregation of human platelets comprising the polypeptide EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH, said preparation being free of phospholipase A contamination.
Dependencies are inferred from the claim text.