Chimeric antigen receptor targeting bcma and use thereof

A BCMA-targeting chimeric antigen receptor, wherein the receptor comprises a humanized BCMA-targeting ScFv structure, wherein the heavy chain variable region ScFv-VH and the light chain variable region ScFv-VL of the ScFv structure are connected by one or more G4S sequences;

• the amino acid sequence of the heavy chain variable region ScFv-VH has at least 90% homology with the following SEQ ID NO.8, preferably at least 95% homology, and more preferably at least 98% homology, SEQ ID NO.8:
• SQVTLRESGPGLVRPSQTLSLTCTVSGGSIDSGGHYWSWIRQHPG
• KGLEWIGSIYHSGNTYYNPSLKSRVTMSVDTSKNQFSLKLTSVTA
• ADTAIYYCARDIPHYFEPAYWGQGTLVTVSS;
• the amino acid sequence of the light chain variable region ScFv-VL has at least 90% homology with the following SEQ ID NO.9, preferably at least 95% homology, and more preferably at least 98% homology:
• SEQ ID NO.9:
• QSALTQPASASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKA
• PKLMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYC
• AIWHSSAWVFGGGTKLTVLG.