Compositions for use in the treatment of endometriosis
AssigneeYeda Research and Development Co. Ltd.
InventorsIrit SAGI, Tamar GROSS
Life of this patent
Estimating the term…
Abstract
The present invention is directed to a pharmaceutical composition including a therapeutically effective amount of an agent capable of inhibiting an active site of a matrix metalloprotease (MMP-7) protein, and use of same in a method for treating endometriosis or ameliorating at least one symptom associated therewith, in a subject in need thereof.
Claims21
-21. (canceled)
A method for treating endometriosis or ameliorating at least one symptom associated therewith in a subject in need thereof, the method comprising administering to said subject a pharmaceutical composition comprising a therapeutically effective amount of an agent capable of inhibiting an active site of a matrix metalloprotease (MMP-7) protein.
A method for treating a subject afflicted with endometriosis or being afflicted with at least one symptom associated therewith, the method comprising:
- (a) determining whether at least one endometrial lesion characterized by increased MMP-7 expression level compared to a healthy control subject is present in said subject;
- and (b) administering to the subject determined as having the at least one endometrial lesion of (a) a pharmaceutical composition comprising a therapeutically effective amount of an agent capable of inhibiting an active site of a matrix metalloprotease (MMP-7) protein.
The method of claim 6, wherein said antibody or antigen-binding portion thereof comprises a heavy chain comprising the amino acid sequence:
- (SEQ ID NO:
- 7)
- EVQLQQSGPELVKPGASVKIPCKASGYTFTDYNMDWMKQSHGKSLEWIGH
- INPNNGGTFYNQKFKDKATFIVDKSSNTAYMELRSLTSEDTAVYFCARGG
- GLRRGPFAYWGQGTLVTVS.
Dependencies are inferred from the claim text.