US 2026/0223846 A1Published application

Peptide in combination with fungicide compositions for fungal control and related methods

AssigneeFlagship Pioneering Innovations Vii, LLC

InventorsHope Hsiao-Wang DANISON, David Barry KOLESKY, Sindhu Manubhai KRISHNANKUTTY, Antonio Diego MARTINEZ, Yajie NIU, Sowmya Ranganayaki RAMACHANDRAN, Michka Gabrielle SHARPE, Joseph Kernan BEDREE

Life of this patent

Estimating the term…

patentgrep

Loading patent…

Abstract

The disclosure provides antifungal compositions comprising conidial germination-inhibiting (CGI) factors, CGI factor precursors, CGI factor fragments, and CGI factor motifs and fungicides. In addition, the disclosure provides methods of controlling or inhibiting fungal growth and infection, as well as methods of treating a fungal disease using the compositions comprising CGI factors, CGI factor precursors, CGI factor fragments, and CGI factor motifs and fungicides.

Claims12

Dependent claims

A method of decreasing growth or reproduction of a fungus, comprising:

providing a fungus with an antifungal composition that comprises:
(a) an effective amount of at least one conidial germination-inhibiting (CGI) factor, CGI factor precursor, CGI factor fragment, or CGI factor motif, wherein the CGI factor, CGI factor precursor, CGI factor fragment, or CGI factor motif comprises:
(i) an alpha pheromone fused at its C terminus to a polyarginine cell-penetrating peptide, optionally having a sequence selected from the group consisting of WHWLQLKPGQPMYRRRRRRRR (SEQ ID NO:2240 or SEQ ID NO:5752), WHWLQLKPGQPMYRRRRRRRRR (SEQ ID NO:5758), SEQ ID NO:5750, 5751, 5754, 5755, 5756, 5757, 5759, 5760, and 5761;
or
(ii) a fusion peptide comprising an alpha pheromone that is fused at its C terminus to a cell-penetrating peptide, wherein the alpha pheromone has a sequence selected from the group consisting of SEQ ID NOs:2182-2186, and wherein the cell-penetrating peptide has a sequence selected from the group consisting of SEQ ID NOs:5736-5749;
(iii) a homodimer of an alpha pheromone, with or without a neutral amino-acid linker, optionally wherein the homodimer is a peptide with a sequence selected from the group consisting of WHWLQLKPGQPMYWHWLQLKPGQPMY (SEQ ID NO:2188), WHWLQLKPGQPMYGGGGWHWLQLKPGQPMY (SEQ ID NO:5837), SEQ ID NOs:
5835-5840, 2189, 5841-5845, and 5846-5911;
or
(iv) an amino acid sequence that has at least 80% sequence identity with a sequence selected from the group consisting of SEQ ID NO:
961-1920, SEQ ID NO:
1921-2189, SEQ ID NO:
2194-2210, SEQ ID NO:
2215-2243, SEQ ID NO:
2457-3361, SEQ ID NO:
5707-5731, and SEQ ID NO:
5755-5911;
and
wherein the nucleotide sequence encoding the at least one CGI factor, CGI factor precursor, CGI factor fragment, or CGI factor motif does not occur in the genome of the fungus;
(b) an effective amount of at least one fungicide selected from the group consisting of:
(i) a fungicide selected from the group consisting of drosomycin, metconazole, and natamycin;
(ii) a fungicide that interferes with fungal cell wall or fungal cell membranes;
(iii) a fungal signal transduction-inhibiting fungicide;
(iv) a fungal respiration-inhibiting fungicide;
and
(v) a fungal amino acid and/or protein synthesis-inhibiting fungicide;
and
(c) optionally, an agriculturally or pharmaceutically acceptable carrier;
whereby the growth or reproduction of the fungus is decreased, relative to a control fungus not provided with the antifungal composition.

25 more elements

A method of preventing or reducing disease caused by a fungus that is a fungal pathogen of a plant, comprising:

contacting one or more cells of the plant with an antifungal composition that comprises
(a) an effective amount of at least one conidial germination-inhibiting (CGI) factor, CGI factor precursor, CGI factor fragment, or CGI factor motif, wherein the CGI factor, CGI factor precursor, CGI factor fragment, or CGI factor motif comprises:
(i) an alpha pheromone fused at its C terminus to a polyarginine cell-penetrating peptide, optionally having a sequence selected from the group consisting of WHWLQLKPGQPMYRRRRRRRR (SEQ ID NO:2240 or SEQ ID NO:5752), WHWLQLKPGQPMYRRRRRRRRR (SEQ ID NO:5758), SEQ ID NO:5750, 5751, 5754, 5755, 5756, 5757, 5759, 5760, and 5761;
or
(ii) a fusion peptide comprising an alpha pheromone that is fused at its C terminus to a cell-penetrating peptide, wherein the alpha pheromone has a sequence selected from the group consisting of SEQ ID NOs:2182-2186, and wherein the cell-penetrating peptide has a sequence selected from the group consisting of SEQ ID NOs:5736-5749;
or
(iii) an amino acid sequence that has at least 80% sequence identity with a sequence selected from the group consisting of SEQ ID NO:
961-1920, SEQ ID NO:
1921-2189, SEQ ID NO:
2194-2210, SEQ ID NO:
2215-2243, SEQ ID NO:
2457-3361, SEQ ID NO:
5707-5731, and SEQ ID NO:
5755-5911;
and
wherein the nucleotide sequence encoding the at least one CGI factor, CGI factor precursor, CGI factor fragment, or CGI factor motif does not occur in the genome of the fungal pathogen;
(b) an effective amount of at least one fungicide selected from the group consisting of:
(i) a fungicide selected from the group consisting of drosomycin, metconazole, and natamycin;
(ii) a fungicide that interferes with fungal cell wall or fungal cell membranes;
(iii) a fungal signal transduction-inhibiting fungicide;
(iv) a fungal respiration-inhibiting fungicide;
and
(v) a fungal amino acid and/or protein synthesis-inhibiting fungicide;
and
(c) optionally, an agriculturally or pharmaceutically acceptable carrier;
whereby disease caused by the fungal pathogen is prevented or decreased in the plant, relative to a control plant not contacted with the antifungal composition.

23 more elements

A method of treating a subject with a disease caused by a fungus, comprising:

administering to the subject an antifungal composition that comprises
(a) an effective amount of at least one conidial germination-inhibiting (CGI) factor, CGI factor precursor, CGI factor fragment, or CGI factor motif, wherein the CGI factor, CGI factor precursor, CGI factor fragment, or CGI factor motif comprises:
(i) an alpha pheromone fused at its C terminus to a polyarginine cell-penetrating peptide, optionally having a sequence selected from the group consisting of WHWLQLKPGQPMYRRRRRRRR (SEQ ID NO:2240 or SEQ ID NO:5752), WHWLQLKPGQPMYRRRRRRRRR (SEQ ID NO:5758), SEQ ID NO:5750, 5751, 5754, 5755, 5756, 5757, 5759, 5760, and 5761;
or
(ii) a fusion peptide comprising an alpha pheromone that is fused at its C terminus to a cell-penetrating peptide, wherein the alpha pheromone has a sequence selected from the group consisting of SEQ ID NOs:2182-2186, and wherein the cell-penetrating peptide has a sequence selected from the group consisting of SEQ ID NOs:5736-5749;
or
(iii) an amino acid sequence that has at least 80% sequence identity with a sequence selected from the group consisting of SEQ ID NO:
961-1920, SEQ ID NO:
1921-2189, SEQ ID NO:
2194-2210, SEQ ID NO:
2215-2243, SEQ ID NO:
2457-3361, SEQ ID NO:
5707-5731, and SEQ ID NO:
5755-5911;
and
wherein the nucleotide sequence encoding the at least one CGI factor, CGI factor precursor, CGI factor fragment, or CGI factor motif does not occur in the genome of the fungus;
(b) an effective amount of at least one fungicide selected from the group consisting of:
(i) a fungicide selected from the group consisting of drosomycin, metconazole, and natamycin;
(ii) a fungicide that interferes with fungal cell wall or fungal cell membranes;
(iii) a fungal signal transduction-inhibiting fungicide;
(iv) a fungal respiration-inhibiting fungicide;
and
(v) a fungal amino acid and/or protein synthesis-inhibiting fungicide;
and
(c) optionally, an agriculturally or pharmaceutically acceptable carrier;
whereby the disease is prevented or decreased in the subject, relative to a control subject not provided with the antifungal composition.

23 more elements

An antifungal composition comprising:

(a) an effective amount of at least one conidial germination-inhibiting (CGI) factor, CGI factor precursor, CGI factor fragment, or CGI factor motif, wherein the CGI factor, CGI factor precursor, CGI factor fragment, or CGI factor motif comprises:
(i) an alpha pheromone fused at its C terminus to a polyarginine cell-penetrating peptide, optionally having a sequence selected from the group consisting of WHWLQLKPGQPMYRRRRRRRR (SEQ ID NO:2240 or SEQ ID NO:5752), WHWLQLKPGQPMYRRRRRRRRR (SEQ ID NO:5758), SEQ ID NO:5750, 5751, 5754, 5755, 5756, 5757, 5758, 5759, 5760, and 5761;
or
(ii) a fusion peptide comprising an alpha pheromone that is fused at its C terminus to a cell-penetrating peptide, wherein the alpha pheromone has a sequence selected from the group consisting of SEQ ID NOs:2182-2186, and wherein the cell-penetrating peptide has a sequence selected from the group consisting of SEQ ID NOs:5736-5749;
or
(iii) an amino acid sequence that has at least 80% sequence identity with a sequence selected from the group consisting of SEQ ID NO:
961-1920, SEQ ID NO:
1921-2189, SEQ ID NO:
2194-2210, SEQ ID NO:
2215-2243, SEQ ID NO:
2457-3361, SEQ ID NO:
5707-5731, and SEQ ID NO:
5755-5911;
and
wherein the nucleotide sequence encoding the at least one CGI factor, CGI factor precursor, CGI factor fragment, or CGI factor motif does not occur in the genome of the fungus;
(b) an effective amount of at least one fungicide selected from the group consisting of:
(i) a fungicide selected from the group consisting of drosomycin, metconazole, and natamycin;
(ii) a fungicide that interferes with fungal cell wall or fungal cell membranes;
(iii) a fungal signal transduction-inhibiting fungicide;
(iv) a fungal respiration-inhibiting fungicide;
and
(v) a fungal amino acid and/or protein synthesis-inhibiting fungicide;
and
(c) optionally, an agriculturally or pharmaceutically acceptable carrier.

21 more elements

Dependencies are inferred from the claim text.

Facts

Application: 19/150,471Filed 23 Jan 2024
Priority: 24 Jan 2023
Published: 6 Aug 2026
Term ends: Not estimatedThe source records don’t support an estimate.

Classification15 codes

A01N 37/46
Containing at least one carboxylic group or a thio analogue, or a derivative thereof, and a nitrogen atom attached to the same carbon skeleton…
C07K 14/37
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof: from fungi
A01N 63/50
Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances…:…
A01P 3/00
Fungicides

Family

Application63/481,318Us provisional application · filed 24 Jan 2023
Application63/481,323Us provisional application · filed 24 Jan 2023
Application63/481,326Us provisional application · filed 24 Jan 2023
Application63/481,331Us provisional application · filed 24 Jan 2023
Application63/481,335Us provisional application · filed 24 Jan 2023
Application63/481,338Us provisional application · filed 24 Jan 2023
Application63/481,345Us provisional application · filed 24 Jan 2023
Application63/481,353Us provisional application · filed 24 Jan 2023
US 2026/0223846 A1This patent

From the US filing history. Foreign family members aren’t listed.