Materials and methods for quantifying precursor tamm-horsfall protein
OwnerTarek M. Ashkar, Radmila Micanovic +2inventors
InventorsTarek M. Ashkar, Radmila Micanovic, Kaice LaFavers, Kavish Patidar
Life of this patent
Estimating the term…
Abstract
Embodiments herein provide compositions, methods, uses for detecting precursor Tamm-Horsfall protein (THP) in a biological sample from a subject. Some embodiments concern polypeptides for use in generating standard curves for an immunoassay. Other embodiments provide methods and kits for detecting precursor THP in a biological sample. Further provided are methods for predicting the risk of a subject (e.g., a human) for developing acute kidney injury or chronic kidney disease.
Claims32
A method for predicting a subject's risk for acute kidney injury or risk for chronic kidney disease, comprising:
- a. detecting a level of precursor Tamm-Horsfall protein (THP) in a biological sample obtained from the subject;
- and
- b. identifying the subject as having an increased risk of acute kidney injury or risk of chronic kidney disease when the detected level of precursor THP in the biological sample obtained from the subject is lower than mean levels of precursor THP in biological samples from a control population.
A polypeptide comprising a first domain comprising an amino acid sequence having at least 95% sequence identity to SVIDQSRVLNLGPITRKGVQAT (SEQ ID NO:
- 3), and a second domain comprising an epitope of mature Tamm-Horsfall protein (THP), wherein the first domain and the second domain are directly joined together, or are separated by 1 to 100 amino acids.
A polypeptide comprising an amino acid sequence having at least 95% sequence identity to DRDNRDWVSVVTPARSVIDQSRVLNLGPITRKGVQAT (SEQ ID NO:
- 6).
A polypeptide having at least 95% sequence identity to DRDNRDWVSVVTPARSVIDQSRVLNLGPITRKGVQAT (SEQ ID NO:
- 6)
A method for quantifying precursor Tamm-Horsfall protein (THP) in a biological sample, the method comprising:
- a. contacting the biological sample with a capture antibody, wherein the capture antibody is an anti-THP antibody or an anti-precursor THP antibody;
- b. incubating the biological sample and the capture antibody to allow for formation of precursor THP-capture antibody complexes;
- c. adding a detection antibody following incubation, wherein the detection antibody is an anti-THP antibody wherein the capture antibody is an anti-precursor THP antibody, or is an anti-precursor THP antibody wherein the capture antibody is an anti-THP antibody;
- and
- d. detecting binding of the detection antibody to any formed precursor THP-capture antibody complexes.
Dependencies are inferred from the claim text.