Protein-based material for recovery and separation of transition metals
OwnerJoseph Alfred COTRUVO, Jr., Jennifer PARKinventors
Life of this patent
Estimating the term…
Abstract
Provided are proteins and protein-based sensors for detecting MnII. The proteins may have the following sequence: Z1-MPTTTTKVDIAAFDPDKDGTIHLKDALAAGSAAFDKLDPD-KDGTLHAKDLKGRVSEADLKKLDPDX1DGTLHKKDYLAAVEAQFKAAX2PDNDGTIX3ARX4LASPAGSALVNLIR-X5-Z2 (SEQ ID NO:1), where Z1 and Z2 correspond to a FRET pair, X1 is N or G, X2 is N or D, X3 is D or H, X4 is E or D, and X5 is optional and is the sequence GSGC (SEQ ID NO:40) and when X5 is present, then Z1 and Z2 are absent. Z1 and Z2 are optional. Also provided are methods of using the proteins to detect and separate MnII. Also provided are compositions, kits, and devices.
Claims20
A protein capable of binding MnII, comprising the following sequence:
- (SEQ ID NO:
- 1)
- Z1-MPTTTTKVDIAAFDPDKDGTIHLKDALAAGSAAFDKLDPDKDGTLH
- AKDLKGRVSEADLKKLDPDX1DGTLHKKDYLAAVEAQFKAAX2PDNDGTI
- X3ARX4LASPAGSALVNLIR-X5-Z2,
- wherein
- Z1 and Z2 are optional and are a Forster resonance energy transfer (FRET) pair;
- X1 is N or G;
- X2 is N or D;
- X3 is D or H,
- X4 is E or D, and
- X5 optional and is the peptide sequence GSGC (SEQ ID NO:40)
- wherein when Z1 is a FRET donor, Z2 is a FRET acceptor and when Z1 is a FRET acceptor, Z2 is a FRET donor, and when X5 is present, then Z1 and Z2 are absent;
- or a protein having at least 75% identity to the residues other than X1, X2, X3, X4, or X5.
Dependencies are inferred from the claim text.