Antagonistic anti-tumor necrosis factor receptor superfamily antibodies
AssigneeThe General Hospital Corporation
InventorDenise L. FAUSTMAN
Life of this patent
Estimating the term…
Abstract
Antagonistic TNFR superfamily polypeptides, such as antibodies and antigen-binding fragments thereof, and the use of these polypeptides to inhibit the proliferation of regulatory T cells (T-regs). For example, antibodies of the invention include antagonistic TNFR2 antibodies and antigen-binding fragments thereof, and can be used to suppress the T-reg-mediated deactivation of tumor reactive T-lymphocytes, as well as to treat a wide variety of cancers and infectious diseases.
Claims19
A humanized or chimeric antibody or antigen-binding fragment thereof capable of specifically binding human tumor necrosis factor receptor 2 (TNFR2), wherein the antibody or antigen-binding fragment thereof specifically binds an epitope of TNFR2 comprising at least five discontinuous or continuous residues within amino acids 150-190 of SEQ ID NO:
- 7 (ARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAI;
- SEQ ID NO:
- 22).
Dependencies are inferred from the claim text.