In pha production

An isolated nucleic acid molecule comprising a sequence encoding a protein having a PhaP1 domain and a HlyA domain, wherein the PhaP1 domain differs from the wild-type Ralstonia eutropha sequence (SEQ ID NO:3)

• SEQ ID NO:
• 3:
• MILTPEQVAAAQKANLETLFGLTTKAFEGVEKLVELNLQVVKTSF
• AEGVDNAKKALSAKDAQELLAIQAAAVQPVAEKTLAYTRHLYEIA
• SETQSEFTKVAEAQLAEGSKNVQALVENLAKNAPAGSESTVAIVK
• SAISAANNAYESVQKATKQAVEIAETNF
• in at least one or more of the following respects:
• the presence of amino acid residue N at position 24
• the presence of amino acid residues ATL at positions 43 to 45
• the presence of amino acid residue N at position 48
• the presence of amino acid residue E at position 50
• the presence of amino acid residue L at position 67
• the presence of amino acid residue L at position 71
• the presence of amino acid residue V at position 79
• the presence of amino acid residue S at position 83
• the presence of amino acid residue A at position 95
• the presence of amino acid residue I at position 105
• the presence of amino acid residue D at position 117
• the presence of amino acid residue V at position 119
• the presence of amino acid residue A at position 130
• the presence of amino acid residue L at position 133
• the presence of amino acid residue V at position 138
• the presence of amino acid residue S at position 161.