Back to results
US 2025/0018009 A1Published application
Serum response factor regenerates senescent cells
AssigneeUniversity of Houston System
InventorsRobert J. SCHWARTZ, Dinakar IYER
Life of this patent
Estimating the term…
Loading patent…
Loading patent…
AssigneeUniversity of Houston System
InventorsRobert J. SCHWARTZ, Dinakar IYER
Estimating the term…
Loss of cardiomyocytes underlies most causes of heart failure, and normal repair processes are inadequate to deal with extensive myocardial damage. The inventors have identified mutations of the N-terminus of serum respose factor (SRF)'s MADS box, termed STEMINs, that block cardiac differentiation, but also powerfully activate the stem cell marker genes Nanog and Octomer 4, as well as cyclins, which promotes adult myocyte replication. SRF Stemin mutations are not cardiac-specific, and also propel mammalian fibroblasts into a proliferative state. Thus, STEMINs may be useful for regeneration of all tissue and organ types, by activating partial pluripotency programs and enhacing repair by increased cell replication. Following withdrawal of STEMINs, the cells then return to normal cell identity.
A method of inducing cell de-differentiation comprising providing to a target cell a STEMIN polypeptide.
A method of inducing cell de-differentiation in a subject comprising providing to a target cell in said subject a STEMIN polypeptide.
17-40. (canceled)
A method preventing or delaying development of cardiac hypertrophy or heart failure in a subject having suffered a myocardial infarct (MI) comprising providing to said subject a STEMIN polypeptide.
42-49. (canceled)
A method of reducing a decrease in exercise tolerance of a subject having suffered a myocardial infarction, reducing hospitalization of a subject having suffered a myocardial infarction, improving quality of life of a subject having suffered a myocardial infarction, decreasing morbidity of a subject having suffered a myocardial infarction, and/or decreasing mortality of a subject having suffered a myocardial infraction, comprising providing to said subject a STEMINs polypeptide.
51-54. (canceled)
A polypeptide comprising at least 22 residues of the sequence SGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLT (SEQ ID NO:
56-60. (canceled)
Dependencies are inferred from the claim text.