Back to results
US 2024/0191208 A1Published application
Minimal Virus-Like Particles and Methods of Use Thereof for Delivery of Biomolecules
OwnerJ. Keith Joung, Peter Cabeceirasinventors
Life of this patent
Estimating the term…
Abstract
Described herein are minimal virus-like particles (mVLPs), comprising a membrane comprising a phospholipid bilayer with one or more ectodomain-truncated VSV envelope glycoproteins on the external side; and a biomolecule cargo disposed in the core of the mVLP on the inside of the membrane. Preferably, the mVLPs do not comprise a protein from viral gag, pro, pol, or other viral proteins that reside inside of enveloped particles. Also described are methods of use of the mVLPs for delivery of the biomolecule cargo to cells.
Claims33
A truncated glycoprotein/envelope protein (tENV) comprising:
- an N-terminal portion comprising a signal sequence, optionally comprising the MKCLLYLAFLFIGVNCK (SEQ ID NO:1), fused to a central portion comprising all or part of a GS domain from at least one vesiculovirus G protein, optionally a VSV-G protein or homolog, ortholog, or paralog thereof, optionally comprising the sequence FEHPHIQDAASQLPDDESLFFGDTGLSKNPIELVEGWFSSWK (SEQ ID NO:2), optionally with a deletion of at least one amino acid (optionally a truncation from the N terminal end of the central portion), which is fused to a C-terminal portion comprising a transmembrane domain and an intracellular domain, optionally comprising
- (SEQ ID NO:
- 3)
- SSIASFFFIIGLIIGLFLVLRVGIHLCIKLKHTKKRQIYTDIEMNRLGK.
1 more element
Dependencies are inferred from the claim text.