# US 2023/0054093 A1 · Treatment

> Agents: this data is available as JSON from the patentgrep API and MCP server — see https://patentgrep.com/llms.txt

- Number: US 2023/0054093 A1
- Document ID: US20230054093A1
- Status: Published application
- Kind: A1
- Application number: 17/753,273
- Filed: 2020-08-28
- Published: 2023-02-23
- Earliest claimed: 2019-08-28
- Assignees: Pneumagen Ltd
- Applicants: Pneumagen Ltd
- Inventors: Helen Connaris; Lei Yang; Jane Alexandra Potter
- Web page: https://patentgrep.com/patent/US20230054093A1

## CPC

- A61K 38/04: Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof ({enzyme inhibitors A61K38/005;} gastrins {A61K38/2207}, somatostatins A61K38/31, melanotropins A61K38/34 {; protease inhibitors A61K38/55})
- A61K 38/164: {from bacteria}
- A61K 9/0043: {Nose}
- A61P 11/00: Drugs for disorders of the respiratory system
- A61P 29/00: Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
- A61K: PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES (devices or methods specially adapted for bringing pharmaceutical products into particular physical or administering forms A61J3/00; chemical aspects of, or use of materials for deodorisation of air, for disinfection or sterilisation, or for bandages, dressings, absorbent pads or surgical articles A61L; soap compositions C11D)
- A61P: SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS

## Abstract

Disclosed are molecules with affinity for (or an ability to bind to) sialic acid (and in particular sialoglycoconjugates) on cell surfaces (these including sialic acid containing glycoproteins and cell surface sialic acid receptors), for use in treating or preventing of inflammatory diseases and/or conditions with an inflammatory aeitiology. The disclosed molecules may be of particular use in the treatment and/or prevention of diseases and/or conditions characterised by inflammation occurring as a consequence of a cascade of cytokines, inflammation that may occur in and around the tissues and/or structures of the lung and inflammation occurring as a result of an infection.

## Claims

### Claim at position 1

1-7. (canceled)

### Claim 8

A method of treating and/or preventing a lung inflammatory disease, pneumonia, bronchiolitis and/or bronchitis, said method comprising administering a subject in need thereof, a therapeutically effective amount of a sialic acid binding molecule.

### Claim 9 (depends on 8)

The method of claim 8, wherein the sialic acid binding molecule comprises or consists essentially of the sequence of SEQ ID NO: 9 or a sequence at least 85% identical thereto.

### Claim 10 (depends on 8)

The method of claim 8, wherein the sialic acid binding molecule comprises or consists essentially of, the following sequence:
GAMVIEKEDVETNASNGQRVDLSSELDKLKKLENATVHMEFKPDPKAPAFYNLFSVSSATKKDEYETMAV
YNNTATLEGRGSDGKQFYNNYNDAPLKVKPGQWNSVTFTVEKPTAELPKGRARLYVNGGLSRTSLRSGNE
IKDMPDVTHVQIGATKRANNTVWGSNLQIRNLTVYNRALTPEEVQKRSGGGSGVIEKEDVETNASNGQRV
DLSSELDKLKKLENATVHMEFKPDPKAPAFYNLFSVSSATKKDEYFTMAVYNNTATLEGRGSDGKQFYNN
YNDAPLKVKPGQWNSVTFTVEKPTAELPKGRARLYVNGGLSRTSLRSGNFIKDMPDVTHVQIGATKRANN
TVWGSNLQIRNLTVYNRALTPEEVQKRSGGSLGVPDFESDWFDVSSNSLYTLSHGLQRSPRRVVVEFARS
SSPSTWNIVMPSYFNDGGHKGSGAQVEVGSLNIKLGTGAAVWGTGYFGGIDNSATTRFATGYYRVRAWI.

### Claim 11 (depends on 8)

The method of claim 8, wherein the sialic acid binding molecule is administered intranasally.

### Claim 12 (depends on 8)

The method of claim 8, wherein the method comprises mucosally administering a composition comprising the sialic acid binding molecule to the subject in need thereof.

### Claim 13 (depends on 8)

The method of claim 8, wherein the method is a method of preventing a lung inflammatory disease, pneumonia, bronchiolitis and/or bronchitis and the sialic acid binding molecule is used prophylactically.

### Claim 14 (depends on 8)

The method of claim 8, wherein the sialic acid binding molecule does not exhibit sialidase activity.

### Claim 15

A method of treating and/or preventing a disease selected from the group consisting of:
(i) inflammatory diseases;
(ii) diseases and/or conditions with an inflammatory aeitiology;
(iii) a lung inflammatory disease;
(iv) inflammation occurring as a consequence of a cascade of cytokines;
(v) pneumonia;
(vi) bronchiolitis; and
(vii) bronchitis;
said method comprising administering to a subject in need thereof, a therapeutically effective amount of a sialic acid binding molecule;
wherein the sialic acid binding molecule comprises, or consists essentially of, the sequence of SEQ ID NO: 9 or a sequence at least 85% identical thereto.