Combination therapies using anti-pseudomonas psl and pcrv binding molecules

An isolated antibody or antigen-binding fragment thereof that specifically binds to Pseudomonas PcrV, wherein the antibody or antigen-binding fragment thereof binds to the same Pseudomonas PcrV epitope as a reference antibody comprising a heavy chain variable region (VH) comprising amino acids EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSAITMSGITAYY TDDVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEFLPGTHYYYGMDVWGQGTT VTVSS (amino acids 1-124 of SEQ ID NO:264) and a light chain variable region (VL) comprising amino acids AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYSASTLQSGVPSRF SGSGSGTDFTLTISSLQPEDFATYYCLQDYNYPWTFGQGTKVEIK (amino acids 1-107 of SEQ ID NO:263).

An isolated antibody or antigen-binding fragment thereof that specifically binds to Pseudomonas PcrV, wherein the antibody or antigen-binding fragment thereof competitively inhibits Pseudomonas PcrV binding by a reference antibody comprising a VH comprising amino acids EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSAITMSGITAYY TDDVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEFLPGTHYYYGMDVWGQGTT VTVSS (amino acids 1-124 of SEQ ID NO:264) and a VL comprising amino acids AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYSASTLQSGVPSRF SGSGSGTDFTLTISSLQPEDFATYYCLQDYNYPWTFGQGTKVEIK (amino acids 1-107 of SEQ ID NO:263).