Novel alpha-1-microglobulin derived proteins and their use

An alpha-1-microglobulin protein variant having an amino acid sequence selected from:

• the amino acid sequence consisting of formula I (SEQ ID NO:10):
• X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12-X13-X4-GPVPTPPDNIQVQENF-X15-ISRIYGKWYNLAIGSTCPWLKKI-X16-DRMTVSTLVLGEGATEAEISMTST-X17-WRKGVCEETSGAYEKTDTDGKFLYHKSKW-X18-ITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPR (formula I), and
• the amino acid sequence consisting of formula II (SEQ ID NO:
• 17):
• (SEQ ID NO:
• 17)
• X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12-X13-X14-GPVPTPPDN
• IQVQENF-X15-ISRIYGKWYNLAIGSTCPWLKKI-X16-DRMTVSTLVLG
• EGATEAEISMTST-X17-WRKGVCEETSGAYEKTDTDGKFLYHKSKW-X18-
• ITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDF
• RVVAQGVGIPEDSIFTMADRGECVPGEQEPEPI,
• wherein
• at least one of X1-X14 is present;
• X1 is absent or represents Met or N-formyl Met;
• X2 is absent or represents His;
• X3 is absent or represents His;
• X4 is absent or represents His;
• X5 is absent or represents His;
• X6 is absent or represents His;
• X7 is absent or represents His;
• X8 is absent or represents His;
• X9 is absent or represents His;
• X10 is absent or selected from Asp, Glu, Lys, or Arg;
• X11 is absent or selected from Asp, Glu, Lys, or Arg;
• X12 is absent or selected from Asp, Glu, Lys, or Arg;
• X13 is absent or selected from Asp, Glu, Lys, or Arg;
• X14 is absent or selected from Asp, Glu, Lys, or Arg;
• X15 represents Asp or Asn;
• X16 represents Met or Lys or Arg;
• X17 represents Arg or His or Lys;
• X18 represents Asp or Asn;
• or a pharmaceutically acceptable salt thereof,
• with the proviso that the amino acid sequence is not SEQ ID NO:
• 1 or SEQ ID NO:
• 2.