Methods of treatment using chlorotoxin conjugates
AssigneeBlaze Bioscience, Inc.
InventorsDennis M. Miller, Kelly Byrnes-Blake
Life of this patent
Estimating the term…
Abstract
Compositions, formulations, and kits comprising chlorotoxin conjugate compounds are provided, including native and modified variants of chlorotoxin peptide conjugated to reporter molecules including fluorescent dyes or conjugated to cytotoxic agents. Dosing and pharmacokinetic profiles for therapeutic and diagnostic applications using chlorotoxin conjugate compounds are provided.
Claims160
A method of administering a composition to a human subject, the method comprising:
- intravenously administering to the human subject a compound comprising a polypeptide having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR (SEQ ID NO:
- 9) or a fragment thereof, wherein the compound is administered at a dosage within a range from about 1 mg to about 100 mg over a time period within a range from about 1 minute to about 120 minutes;
- and
- producing an average maximum blood plasma concentration (average Cmax) in the human subject within a range from about 15 ng/mL to about 600 ng/mL per each 1 mg dosage of the compound administered.
A method of administering a composition to a human subject, the method comprising:
- intravenously administering to the human subject a compound comprising a polypeptide having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with any one of SEQ ID NO:
- 1-SEQ ID NO:
- 481 or a fragment thereof, wherein the compound is administered at a dosage within a range from about 1 mg to about 100 mg over a time period within a range from about 1 minute to about 120 minutes;
- and
- producing an average maximum blood plasma concentration (average Cmax) in the human subject within a range from about 15 ng/mL to about 600 ng/mL per each 1 mg dosage of the compound administered.
A method of administering a composition to a human subject, the method comprising:
- intravenously administering to the human subject a compound comprising a polypeptide of any one of SEQ ID NO:
- 482-SEQ ID NO:
- 485 or a fragment thereof, wherein the compound is administered at a dosage within a range from about 1 mg to about 100 mg over a time period within a range from about 1 minute to about 120 minutes;
- and
- producing an average maximum blood plasma concentration (average Cmax) in the human subject within a range from about 15 ng/mL to about 600 ng/mL per each 1 mg dosage of the compound administered.
The method of claim 51, wherein the average Vd decreases as the rate of administration of the compound decreases. For example, the average Vd of the compound administered at a rate of greater than 0.2 mg/min to 120 mg/min is up to 2 times, up to 3 times, up to 4 times, or up to 5 times greater than the average Vd of the compound administered at a rate of 0.0007 mg/min to 0.2 mg/min.
A method of administering a composition to a human subject, the method comprising:
- determining a rate of administration of a compound to a human subject, the compound comprising a polypeptide having at least 80% sequence identity with MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR (SEQ ID NO:
- 9) or a fragment thereof, wherein a pharmacokinetic profile of the compound in the human subject varies according to the rate of administration of the compound;
- and
- intravenously administering the compound to the human subject at the determined rate.
A method of administering a composition to a human subject, the method comprising:
- determining a rate of administration of a compound to a human subject, the compound comprising a polypeptide having at least 80% sequence identity with any one of SEQ ID NO:
- 1-SEQ ID NO:
- 481 or a fragment thereof, wherein a pharmacokinetic profile of the compound in the human subject varies according to the rate of administration of the compound;
- and
- intravenously administering the compound to the human subject at the determined rate.
A method of administering a composition to a human subject, the method comprising:
- determining a rate of administration of a compound to a human subject, the compound comprising a polypeptide any one of SEQ ID NO:
- 482-SEQ ID NO:
- 485 or a fragment thereof, wherein a pharmacokinetic profile of the compound in the human subject varies according to the rate of administration of the compound;
- and
- intravenously administering the compound to the human subject at the determined rate.
Dependencies are inferred from the claim text.