Back to results
US 2019/0136264 A1Published application
Particles Coated With Catalysts Useful for Splicing Nucleic Acids
AssigneeEmory University
InventorsKhalid Salaita, Jessica Petree, Kevin Yehl
Life of this patent
Estimating the term…
Abstract
This disclosure relates to compositions comprising particles conjugated to one or more catalytically cleaving nucleic acids and optionally an RNA ligating enzyme. In certain embodiments, particles reported herein are used for splicing nucleic acid sequences.
Claims16
A composition comprising a particle comprising;
- i) a first site-specific RNA cleaving nucleic acid,
- ii) a second site-specific RNA cleaving nucleic acid, and
- iii) a ligase enzyme,
- wherein the first site-specific RNA cleaving nucleic acid comprises a cleaving sequence flanked on a 3′ end with a first sequence that hybridizes to a first target sequence and flanked on the 5′ end with a second sequence that hybridizes to a second target sequence;
- and
- wherein the second site specific RNA cleaving nucleic acid comprises a cleaving sequence flanked on the a 3′ end with a third sequence that hybridizes to a third target sequence and flanked on the 5′ end with a fourth sequence that hybridizes to a fourth target sequence.
3 more elements
A composition comprising a ligase enzyme and a particle comprising;
- i) a first site-specific RNA cleaving nucleic acid,
- ii) a second site-specific RNA cleaving nucleic acid, and
- wherein the first site-specific RNA cleaving nucleic acid comprises a cleaving sequence flanked on a 3′ end with a first sequence that hybridizes to a first target sequence and flanked on the 5′ end with a second sequence that hybridizes to a second target sequence;
- and
- wherein the second site specific RNA cleaving nucleic acid comprising a cleaving sequence flanked on the a 3′ end with a third sequence that hybridizes to a third target sequence and flanked on the 5′ end with a fourth sequence that hybridizes to a fourth target sequence.
2 more elements
A ligating enzyme comprising
- (SEQ ID NO:
- 1)
- 5′-CCGNYELLTTENAPVKMWTKGVPVEADARQQLINTAKMPFIFKHIAVM
- PDVHLGKGSTIGSVIPTKGAIIPAAVGVDIGCGMNALRTALTAEDLPENLA
- ELRQAIETAVPHGRTTGRCKRDKGAWENPPVNVDAKWAELEAGYQWLTQKY
- PRFLNTNNYKHLGTLGTGNHFIEICLDESDQVWIMLHSGSRGIGNAIGTYF
- IDLAQKEMQETLETLPSRDLAYFMEGTEYFDDYLKAVAWAQLFASLNRDAM
- MENVVTALQSITQKTVRQPQTLAMEEINCHHNYVQKEQHFGEEIYVTRKGA
- VSARAGQYGIIPGSMGAKSFIVRGLGNEESFCSCSHGAGRVMSRTKAKKLF
- SVEDQIRATAHVECRKDAEVIDEIPMAYKDIDAVMAAQSDLVEVIYTLRQV
- VCVKG.
8 more elements
Dependencies are inferred from the claim text.