Antibodies to sericin and methods and kits using same
AssigneeCerapedics, Inc.
InventorsJames J. BENEDICT, Tristan Stuart BARNES, Claude George LERNER
Life of this patent
Estimating the term…
Abstract
The present invention relates to antibodies that bind to a polypeptide at an epitope in the amino acid sequence of SEQ ID NO: 1 (e.g., a sericin polypeptide). The invention also provides methods and kits using the antibodies of the invention. In some embodiments, the antibody binds to a polypeptide at an epitope in the amino add sequence of SEQ ID NO: 2. In some embodiments, the antibody binds to a polypeptide at an epitope in the amino add sequence of SEQ ID NO: 3. In some embodiments, the polypeptide is a sericin polypeptide (e.g., a sericin isoform 1B polypeptide). In a related aspect, the invention features a method for selectively detecting sericin in a sample.
Claims45
An antibody that binds to a polypeptide at an epitope in the amino acid sequence RSHHSGVNRLLHKPGQGKICLCFENIFDIPYHLRK (SEQ ID NO:
- 1).
A method for selectively detecting sericin in a sample, the method comprising the steps of:
- (a) immobilizing the sample to a solid support to form an immobilized sample;
- (b) contacting the immobilized sample with a capture antibody to form an immobilized sericin-capture antibody complex, wherein the capture antibody binds to sericin at an epitope within residues 1148-1182 of sericin (SEQ ID NO:
- 1);
- (c) separating unbound capture antibody from the immobilized sericin-capture antibody complex;
- and
- (d) measuring the level of sericin bound to the capture antibody using a detection means for the capture antibody.
A method for selectively detecting sericin in a sample, the method comprising the steps of:
- (a) immobilizing the sample to a solid support to form an immobilized sample;
- (b) contacting the immobilized sample with a capture antibody to form an immobilized sericin-capture antibody complex, wherein the capture antibody binds to sericin at an epitope within residues 1148-1182 of sericin (SEQ ID NO:
- 1);
- (c) separating unbound capture antibody from the immobilized sericin-capture antibody complex;
- (d) contacting the immobilized sericin-capture antibody complex with a detectable antibody that binds the capture antibody to form an immobilized sericin-capture antibody-detectable antibody complex;
- (e) separating unbound detectable antibody from the immobilized sericin-capture antibody-detectable antibody complex;
- and
- (f) measuring the level of sericin bound to the capture antibody using a detection means for the detectable antibody.
A method for selectively detecting sericin in a sample, the method comprising the steps of:
- (a) immobilizing a capture antibody to a solid support to form an immobilized capture antibody, wherein the capture antibody binds to sericin at an epitope within residues 1148-1182 of sericin (SEQ ID NO:
- 1);
- (b) contacting the immobilized capture antibody with the sample to form an immobilized capture antibody-sericin complex;
- (c) separating unbound sample from the immobilized capture antibody-sericin complex;
- (d) contacting the immobilized capture antibody-sericin complex with a detectable antibody that binds to sericin at an epitope within residues 1-1147 of sericin (SEQ ID NO:
- 4) or residues 1182-1186 of sericin (SEQ ID NO:
- 5) to form an immobilized capture antibody-sericin-detectable antibody complex;
- (e) separating unbound detectable antibody from the immobilized capture antibody-sericin-detectable antibody complex;
- and
- (f) measuring the level of sericin bound to the capture antibody using a detection means for the detectable antibody.
An immunoassay kit for selectively detecting sericin in a sample, wherein the immunoassay kit comprises:
- (a) a capture antibody that binds to sericin at an epitope within residues 1148-1182 of sericin (SEQ ID NO:
- 1);
- and
- (b) a solid support.
Dependencies are inferred from the claim text.