# US 2013/0156804 A1 · Porin B (PorB) as a Therapeutic Target for Prevention and Treatment of Infection by Chlamydia > Agents: this data is available as JSON from the patentgrep API and MCP server — see https://patentgrep.com/llms.txt - Number: US 2013/0156804 A1 - Document ID: US20130156804A1 - Status: Published application - Kind: A1 - Application number: 13/682,513 - Filed: 2012-11-20 - Published: 2013-06-20 - Earliest claimed: 2002-03-07 - Assignees: The Regents of the University of California - Inventors: Richard S. Stephens; Diane Kawa - Web page: https://patentgrep.com/patent/US20130156804A1 ## CPC - A61K 39/118: Chlamydiaceae, e.g. Chlamydia trachomatis or Chlamydia psittaci - A61P 31/04: Antibacterial agents - A61P 37/04: Immunostimulants - C07K 14/295: from Chlamydiales (O) - G01N 33/56927: {Chlamydia} - A61K 39/00: Medicinal preparations containing antigens or antibodies (materials for immunoassay G01N33/53) - A61K 2039/53: {DNA (RNA) vaccination} - Y10S 530/806: Antigenic peptides or proteins - Y10S 530/825: Bacteria - A61K: PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES (devices or methods specially adapted for bringing pharmaceutical products into particular physical or administering forms A61J3/00; chemical aspects of, or use of materials for deodorisation of air, for disinfection or sterilisation, or for bandages, dressings, absorbent pads or surgical articles A61L; soap compositions C11D) - A61P: SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS - C07K: PEPTIDES (peptides in foodstuffs A23; obtaining protein compositions for foodstuffs, working-up proteins for foodstuffs A23J; preparations for medicinal purposes A61K; peptides containing beta-lactam rings C07D; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, C07D; ergot alkaloids of the cyclic peptide type C07D519/02; macromolecular compounds having statistically distributed amino acid units in their molecules, i.e. when the preparation does not provide for a specific; but for a random sequence of the amino acid units, homopolyamides and block copolyamides derived from amino acids C08G69/00; macromolecular products derived from proteins C08H1/00; preparation of glue or gelatine C09H; single cell proteins, enzymes C12N; genetic engineering processes for obtaining peptides C12N15/00; compositions for measuring or testing processes involving enzymes C12Q; investigation or analysis of biological material G01N33/00) - G01N: INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES (measuring or testing apparatus or processes other than immunoassay, involving enzymes or microorganisms C12M, C12Q) - Y10S: TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS ## Abstract The present invention features peptides of a PorB polypeptide, which PorB peptides are useful in production of antibodies that bind the full-length PorB polypeptide and as a therapeutic agent. In specific embodiments the invention features a composition comprising one or more PorB peptides (other than a full-length PorB polypeptide), which peptides contain at least one epitope that can elicit Chlamydia-neutralizing antibodies. The invention also features methods for induction of a protective immune response against infection by Chlamydia and Chlamydiophila. ## Claims ### Claim at position 1 -32. (canceled) ### Claim 33 A composition comprising: an isolated C. pneumoniae PorB polypeptide up to 60 amino acids in length wherein the isolated polypeptide contains an amino acid sequence that is at least 67% identical to the amino acid sequence GMIEVQSNYGFVWDVSLKKV (SEQ ID NO: 15), wherein the isolated polypeptide binds to neutralizing C. trachomatis PorB polypeptide-specific antisera; and a pharmaceutically acceptable carrier. ### Claim 34 (depends on 33) The composition of claim 33, wherein the isolated polypeptide contains the amino acid sequence of GMIEVQSNYGFVWDVSLKKV (SEQ ID NO: 15). ### Claim 35 (depends on 33) The composition of claim 33, wherein the isolated polypeptide contains the amino acid sequence GMIEVQSNYGFVWDVSLKKVIWKDGVSFVGVGADYRHASCPIDYIIA (SEQ ID NO:9). ### Claim 36 (depends on 33) The composition of claim 33, wherein the isolated polypeptide contains the amino acid sequence GLIEVQSDYGIVWGLSLQKV (SEQ ID NO:40). ### Claim 37 (depends on 33) The composition of claim 33, wherein the isolated polypeptide comprises at least 20 amino acids. ### Claim 38 A composition comprising: an isolated polypeptide up to 60 amino acids in length, wherein the isolated polypeptide contains an amino acid sequence of SEQ ID NO: 15 (GMIEVQSNYGFVWDVSLKKV), or an amino acid sequence of SEQ ID NO: 15 comprising at least one conservative amino acid substitution, wherein the isolated polypeptide binds to neutralizing C. trachomatis PorB polypeptide-specific antisera; and a pharmaceutically acceptable carrier. ### Claim 39 (depends on 38) The composition of claim 38, wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence different from the amino acid sequence of SEQ ID NO: 15 or SEQ ID NO: 15 comprising at least one conservative amino acid substitution. ### Claim 40 (depends on 38) The composition of claim 38, wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence selected from the group consisting of: SEQ ID NO:7 (ND1), SEQ ID NO:8 (ND2), and SEQ ID NO:10 (ND4). ### Claim 41 (depends on 38) The composition of claim 38, wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence selected from the group consisting of: SEQ ID NO:11 (B1-2), SEQ ID NO:14 (B2-4), SEQ ID NO:16 (B3-3), SEQ ID NO:17 (B3-4), SEQ ID NO:18 (B4-4), and SEQ ID NO:19 (B5-1). ### Claim 42 (depends on 38) The composition of claim 38, wherein the isolated polypeptide is a C. trachomatis PorB polypeptide. ### Claim 43 (depends on 38) The composition of claim 38, wherein the isolated polypeptide is a polypeptide of amino acid sequence of SEQ ID NO:9 (GMIEVQSNYGFVWDVSLKKVIWKDGVSFVGVGADYRHASCPI DYIIA). ### Claim 44 A composition comprising: an isolated polypeptide up to 60 amino acids in length, wherein the isolated polypeptide contains an amino acid sequence of SEQ ID NO: 17 (FVGVGADYRHASCPIDYIIA), or an amino acid sequence of SEQ ID NO: 17 comprising at least one conservative amino acid substitution, wherein the isolated polypeptide binds to neutralizing C. trachomatis PorB polypeptide-specific antisera; and a pharmaceutically acceptable carrier. ### Claim 45 (depends on 44) The composition of claim 44, wherein the isolated polypeptide contains the amino acid sequence of SEQ ID NO: 17, and wherein the isolated polypeptide is a fusion polypeptide comprising a non-PorB amino acid sequence and the amino acid sequence of SEQ ID NO:17. ### Claim 46 (depends on 44) The composition of claim 44, wherein the isolated polypeptide contains the amino acid sequence of SEQ ID NO: 17 comprising at least one conservative amino acid substitution. ### Claim 47 (depends on 46) The composition of claim 46, wherein the isolated polypeptide is a fusion polypeptide comprising a non-PorB amino acid sequence and the amino acid sequence of SEQ ID NO:17 comprising at least one conservative amino acid substitution. ### Claim 48 (depends on 44) The composition of claim 44, wherein the isolated polypeptide is a polypeptide of amino acid sequence of SEQ ID NO:9 (GMIEVQSNYGFVWDVSLKKVIWKDGVSFVGVGADYRHASCPI DYIIA). ### Claim 49 (depends on 44) The composition of claim 44, wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence different from the amino acid sequence of SEQ ID NO: 17 or SEQ ID NO: 17 comprising at least one conservative amino acid substitution. ### Claim 50 (depends on 44) The composition of claim 44, wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence selected from the group consisting of: SEQ ID NO:7 (ND1), SEQ ID NO:8 (ND2), and SEQ ID NO:10 (ND4). ### Claim 51 (depends on 44) The composition of claim 44, wherein the composition additionally comprises at least one PorB polypeptide with an amino acid sequence selected from the group consisting of: SEQ ID NO:11 (B1-2), SEQ ID NO:14 (B2-4), SEQ ID NO:15 (B3-2), SEQ ID NO:16 (B3-3), SEQ ID NO:18 (B4-4), and SEQ ID NO:19 (B5-1). ### Claim 52 (depends on 44) The composition of claim 44, wherein the isolated polypeptide is a C. trachomatis PorB polypeptide.