Dendritic cell receptor
AssigneeThe Corporation of the Trustees of the Order of the Sisters of Mercy in Queensland
InventorDerek N. Hart
Life of this patent
Estimating the term…
Abstract
The invention provides isolated human DEC-205, its extracellular domain and functionally equivalent fragments thereof. Also provided are polynucleotides encoding same and vectors which include such polynucleotides. Further provided are methods of recombinantly producing human DEC-205, an extracellular domain thereof or a functionally equivalent fragment, and ligands that bind to human DEC-205 or a fragment thereof. Also provided are constructs for use in prophylaxis or therapy comprising such a ligand, human DEC-205 or an extracellular domain thereof coupled to a toxin or to an antigen capable of inducing a protective immune response in a patient.
Claims22
Isolated human DEC-205 which has an approximate molecular weight of 198-205 kDa and which includes the following amino acid sequences:
- (i)
- TVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPF
- QNCCYNFIITKNRHMATTQDEVQSTCEKLHPKSHILSIRDEKE
- NNFVLEQLLYFNYMASWVMLGITYRNNSL;
- and
- (ii)
- SQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAML;
- or a functionally equivalent fragment thereof.
Isolated human DEC-205 which comprises the amino acid sequence of FIG. 11, or a functionally equivalent fragment thereof.
Isolated human DEC-205 in mature form which comprises amino acids 27 to 1722 of the amino acid sequence of FIG. 11.
The extracellular domain of human DEC-205 having an amino acid sequence which includes amino acids 27 to 1661 of FIG. 11 or a functionally equivalent fragment thereof.
A vector which includes a polynucleotide as claimed in claim 12.
A method of producing human DEC-205, an extracellular domain thereof or a functionally equivalent fragment comprising the steps of:
- (a) culturing a host cell which has been transformed or transfected with a vector as defined above to express the encoded human DEC-205, extracellular domain or fragment;
- and
- (b) recovering the expressed human DEC-205, extracellular domain or fragment.
Dependencies are inferred from the claim text.