Fplr-1 inhibitors for use in diseases involving amyloid-induced inflammatory events (flipr and flipr-like) and immunecomplex-mediated diseases
OwnerCornelis Petrus Maria Van Kessel, Johannes Antonius Gerardus Van Strijpinventors
Life of this patent
Estimating the term…
Abstract
The present invention relates to a FPLR-1 inhibitor selected from the group consisting of FLIPr having the amino acid sequence MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGG FLIPr-like having the amino acid sequence MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERADKLIKEADEKNEHYKGKTVEDLYVIAKKMGKGNTIAVVKIKDGGK fragments of a) or b) having FPLR-1 inhibitory activity; homologues of a), b) or c) having FPLR-1 inhibitory activity; or derivatives of a), b), c) or d) having FPLR-1 inhibitory activity.
Claims29
A FPLR-1 inhibitor selected from the group consisting of:
- a) a FLIPr having the amino acid sequence:
- MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKD
- DERIDKLMKESDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGGP
- RDYYTFDLTRPLEENRKNIKVVKNGEIDSIYWD;
- b) a FLIPr-like having the amino acid sequence:
- MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKD
- DERADKLIKEADEKNEHYKGKTVEDLYVIAKKMGKGNTIAVVKIKDGGKN
- GYYTFDITRPLEEHRKNIPVVKNGEIDSITWY;
- c) fragments of a) or b) having FPLR-1 inhibitory activity;
- d) homologues of a), b) or c) having FPLR-1 inhibitory activity;
- and
- e) derivatives of a), b), c) or d) having FPLR-1 inhibitory activity.
Dependencies are inferred from the claim text.