Novel albumins
OwnerStephen Berezenko, Peter Sadler +3inventors
InventorsStephen Berezenko, Peter Sadler, Alan Stewart, Claudia Blindauer, Kerry Bunyan
Life of this patent
Estimating the term…
Abstract
The present invention relates to mutated forms of serum albumin, which display altered metal binding and/or other characteristics with respect to a native albumin from which the mutant has been derived, as well as uses of such mutant albumins in the medical field or in growth of cells in culture.
Claims21
An isolated mutant human serum albumin substantially comprising the amino acid sequence:
- (SEQ ID NO.:1)
- DAHKSEVAHRFKDLGEENFKALVLIAFAQX5LQQCPFEDHVKLVNEVTEF
- AKTCVADESAENCDKSLX1TLFGDKLCTVATLRETYGEMADCCAKQEPER
- X2X8CFX6QHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARR
- X9PYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSA
- KQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVX10
- TECCX3X7X4LLECADDRADLAKYICENQDSISSKLKECCEKPLLEKS
- X11CIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYA
- RRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQ
- NLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGS
- KCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRR
- PCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKH
- KPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL
- wherein X1, is other than H;
- X2 is other than N, X3 is other than H, X4 is other than D;
- X5 is other than Y;
- X6 is other than L;
- X7 is other than G, X8 is other than E, X9 is other than H, X10 is other than H, and X11 is other than H, such that said mutant displays an altered metal binding affinity or one or more physiological characteristics with respect to native human serum albumin.
An isolated mutant mammalian serum albumin substantially comprising one of the sequences as shown in Table 1 wherein at least one of the residues denoted by Xn is mutated such that said mutant serum albumin displays an altered metal binding affinity or one or more physiological characteristics with respect to the native sequence from which the mutant is derived.
A mutant human serum albumin comprising the mutation Asn 99His, Asn99Asp or His67Ala.
(canceled)
A method of obtaining a mutant serum albumin which displays an altered metal binding affinity or one or more physiological characteristics with respect to a native albumin from which the mutant has been derived, comprising the steps of:
- a) providing a nucleic acid sequence encoding a nucleic albumin polypeptide;
- b) conducting a mutagenesis reaction on said nucleic acid in order to alter said nucleic acid whereby said altered nucleic acid sequence encodes a mutant albumin polypeptide comprising at least one mutation with respect to said native albumin;
- c) expressing said mutant albumin polypeptide and detecting whether or not said mutant albumin displays an altered metal binding or one or more physiological characteristics.
A method of obtaining a mutant serum albumin which displays an altered metal binding affinity and one or more physiological characteristics with respect to a native albumin from which the mutant has been derived, comprising the steps of:
- a) providing a nucleic acid sequence encoding a nucleic albumin polypeptide;
- b) conducting a mutagenesis reaction on said nucleic acid in order to alter said nucleic acid whereby said altered nucleic acid sequence encodes a mutant albumin polypeptide comprising at least one mutation with respect to said native albumin;
- c) expressing said mutant albumin polypeptide and detecting whether or not said mutant albumin displays an altered metal binding and said one or more physiological characteristics.
Dependencies are inferred from the claim text.