Composition and Method for Selective Cytostasis
OwnerJoseph Kilmoninventor
Life of this patent
Estimating the term…
Abstract
A method of inducing cytostasis in a population of HIV-infected cells is disclosed which comprises applying to a population of HIV-infected cells a cytostatically effective amount of an inhibitor comprising an isolated peptide having the amino acid sequence FCRFLLCPSRTSD or SQCEQEGGRCRFLLCPSRTSNIGKLGCEPLWKC CKRWGG, or a conservative variant thereof, whereby cell growth in at least a portion of the HIV-infected cells is arrested, rendering the growth-arrested cells non-HIV producing. The peptide may be conjugated with an agent that is capable of selectively targeting HIV-infected cells.
Claims17
A method of inducing cytostasis in a population of HIV-infected cells, the method comprising applying to said population of HIV-infected cells a cytostatically effective amount of an inhibitor comprising an isolated peptide having the amino acid sequence of residues 9-21 of SEQ ID NO:
- 1, or of SEQ ID NO:
- 1 or a conservative variant thereof, whereby cell growth in at least a portion of said HIV-infected cells is arrested, rendering said growth-arrested cells non-HIV producing.
A method of treating a patient suffering from HIV/AIDS, comprising:
- administering to a patient suffering from HIV/AIDS cytostatically effective amount of an inhibitor comprising an isolated peptide having the amino acid sequence of residues 9-21 of SEQ ID NO:
- 1, or of SEQ ID NO:
- 1 or a conservative variant thereof, wherein said inhibitor is selectively targeted to associate with HlV-infected cells in said patient, whereby cell growth in at least a portion of said HIV-infected cells is arrested, rendering said growth-arrested cells non-HIV producing.
Dependencies are inferred from the claim text.